BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0490.Seq (898 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC167.03c |snu66||U4/U6 x U5 tri-snRNP complex subunit Snu66 |... 26 6.3 SPBC1711.08 |||chaperone activator Aha1 |Schizosaccharomyces pom... 26 6.3 >SPAC167.03c |snu66||U4/U6 x U5 tri-snRNP complex subunit Snu66 |Schizosaccharomyces pombe|chr 1|||Manual Length = 649 Score = 26.2 bits (55), Expect = 6.3 Identities = 10/36 (27%), Positives = 22/36 (61%) Frame = -2 Query: 498 IKESRRGLGEVDRIARPYEDIVDRLREEYSEGKGSK 391 ++E RR E DR++ +E + + RE+Y++ + + Sbjct: 539 LEEQRRKKKEQDRLSGKFEKMTQKEREQYAKKENER 574 >SPBC1711.08 |||chaperone activator Aha1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 336 Score = 26.2 bits (55), Expect = 6.3 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 304 TWSLNMWPVGHRREL 260 TW L+ WP GH E+ Sbjct: 272 TWRLSSWPTGHYAEI 286 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,601,205 Number of Sequences: 5004 Number of extensions: 73404 Number of successful extensions: 170 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 166 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 170 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 452494940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -