BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0487.Seq (923 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57380.1 68418.m07169 fibronectin type III domain-containing ... 30 2.5 At3g28880.1 68416.m03605 ankyrin repeat family protein contains ... 28 7.6 >At5g57380.1 68418.m07169 fibronectin type III domain-containing protein / PHD finger protein-related contains Pfam profiles PF00041: Fibronectin type III domain, PF00628: PHD-finger Length = 600 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +1 Query: 118 DRDRVECCSSLEQESTIKERGLQRQRAKNRLSGR 219 D+D E CS+ E ES ++E L +++A N++ GR Sbjct: 434 DKDNTEHCSAGEVESELEEERLVKRKA-NKIDGR 466 >At3g28880.1 68416.m03605 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 762 Score = 28.3 bits (60), Expect = 7.6 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +2 Query: 503 VYFLNTFKYVSAHETITLINASIILKKEEYEYSTFPCRPYSLFC 634 V+FL F + ++ET K ++ FPCR + L+C Sbjct: 651 VFFLREFDFYQSYETCLKEGMCFWCNKNMIRWANFPCR-HKLWC 693 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,515,781 Number of Sequences: 28952 Number of extensions: 319846 Number of successful extensions: 744 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 744 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2197951248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -