BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0483.Seq (939 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14360| Best HMM Match : TFIIS_C (HMM E-Value=0.032) 29 5.4 SB_37000| Best HMM Match : Astacin (HMM E-Value=5.5e-19) 28 9.5 >SB_14360| Best HMM Match : TFIIS_C (HMM E-Value=0.032) Length = 299 Score = 29.1 bits (62), Expect = 5.4 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 570 LKLMTCINISYIYRYVWLILEF 635 +KL++C+ +S IY WL LEF Sbjct: 153 VKLISCMYVSVIYPLFWLALEF 174 >SB_37000| Best HMM Match : Astacin (HMM E-Value=5.5e-19) Length = 1341 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 223 RRRRMILLGSVRPPARPDDACSCTTNVHSLFIHFAFII 336 +RRR L VR PA P+ N+ ++++H FII Sbjct: 1257 QRRRPTLAQRVRSPATPNTIKEPPKNLVTIYLHGTFII 1294 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,673,849 Number of Sequences: 59808 Number of extensions: 396412 Number of successful extensions: 822 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 745 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 822 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2740956230 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -