BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0483.Seq (939 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L14433-3|AAA27977.1| 2329|Caenorhabditis elegans Yeast prp (spli... 29 6.3 AF099920-4|AAK29844.2| 363|Caenorhabditis elegans Serpentine re... 28 8.4 >L14433-3|AAA27977.1| 2329|Caenorhabditis elegans Yeast prp (splicing factor) relatedprotein 8 protein. Length = 2329 Score = 28.7 bits (61), Expect = 6.3 Identities = 15/56 (26%), Positives = 30/56 (53%) Frame = +1 Query: 139 NNVFISSLNAGEVNDIIVVLDLSSS*EHRRRRMILLGSVRPPARPDDACSCTTNVH 306 NNV ++SL EV DII+ +++S+ + R++ + + ++ + T N H Sbjct: 1988 NNVNVASLTQSEVRDIILGMEISAPSQQRQQIADIEKQTKEQSQVTATTTRTVNKH 2043 >AF099920-4|AAK29844.2| 363|Caenorhabditis elegans Serpentine receptor, class w protein95 protein. Length = 363 Score = 28.3 bits (60), Expect = 8.4 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Frame = +3 Query: 594 ISYIYRYVWLILEFG---CLPPTRLXETVGFNXIIVVNNKY 707 +S IY Y++LILEF C PP L + +V+N+ + Sbjct: 89 VSIIYNYLYLILEFNVKPCEPPAPLSFFYMYWINVVINDLF 129 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,358,249 Number of Sequences: 27780 Number of extensions: 314525 Number of successful extensions: 749 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 729 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 749 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2423194158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -