BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0476.Seq (798 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 24 1.2 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 3.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 3.7 DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like pr... 21 8.6 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 267 RQRTGGRGDPRAKRCEGK 320 R +T RGDP +CE K Sbjct: 804 RNQTSRRGDPAVLQCEAK 821 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.6 bits (46), Expect = 3.7 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -1 Query: 282 PLSSAYRPLNTALFRKKNTNFPNSRSGXRSLADLRWP 172 P SA+R + A +++ + PN S R LR+P Sbjct: 1409 PSISAFRKKSLAYVQQRMSIAPNRVSQARPSVQLRYP 1445 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.6 bits (46), Expect = 3.7 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -1 Query: 282 PLSSAYRPLNTALFRKKNTNFPNSRSGXRSLADLRWP 172 P SA+R + A +++ + PN S R LR+P Sbjct: 1409 PSISAFRKKSLAYVQQRMSIAPNRVSQARPSVQLRYP 1445 >DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like protein protein. Length = 135 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +3 Query: 243 REQY*EVGRQRTGGRGDPRAKRCEG 317 +E++ E+GR + G+ +CEG Sbjct: 37 KEEFDELGRLQRICNGEVAVNKCEG 61 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,367 Number of Sequences: 336 Number of extensions: 3407 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -