BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0476.Seq (798 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15340.1 68417.m02346 pentacyclic triterpene synthase (04C11)... 29 2.7 At5g36150.1 68418.m04356 pentacyclic triterpene synthase, putati... 29 4.7 At3g52680.1 68416.m05803 F-box family protein contains F-box dom... 28 8.3 >At4g15340.1 68417.m02346 pentacyclic triterpene synthase (04C11) identical to pentacyclic triterpene synthase [gi:6650208] [PMID:11247608] Length = 766 Score = 29.5 bits (63), Expect = 2.7 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = -1 Query: 276 SSAYRPLNTALFRKKNTNFPNSRSGXRSLADLRWPTASILIADYEPKPDRGRVQ 115 ++A P A + NF N+RS ++ ADL W + +E K R RV+ Sbjct: 32 ANAGSPQELAEVEEARRNFSNNRSHYKASADLLWRMQFLREKGFEQKIPRVRVE 85 >At5g36150.1 68418.m04356 pentacyclic triterpene synthase, putative similar to pentacyclic triterpene synthase [gi:6650208] [PMID:11247608]; oxidosqualene cyclase; also highly similar to beta-amyrin synthase, lupeol synthase, cycloartenol synthase Length = 729 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = -1 Query: 276 SSAYRPLNTALFRKKNTNFPNSRSGXRSLADLRWPTASILIADYEPKPDRGRVQ 115 ++A P + + NF N+RS ++ ADL W + ++E K R R++ Sbjct: 32 ANAGSPAELSEVDQARQNFSNNRSQYKACADLLWRMQFLREKNFEQKIPRVRIE 85 >At3g52680.1 68416.m05803 F-box family protein contains F-box domain Pfam:PF00646 Length = 456 Score = 27.9 bits (59), Expect = 8.3 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = -1 Query: 357 PAILSTCTPSTVLSLHTALPVDPPVP-LSSAYRPLNTALFR-KKNTNFPNSRSGXRSLAD 184 P+ L TC L L + VD P P L + R L+ R K ++ N SG L + Sbjct: 141 PSSLCTCNTLETLKLVLCILVDIPSPVLMKSLRTLHLEFVRYKDESSVRNLLSGCPGLEE 200 Query: 183 LR 178 LR Sbjct: 201 LR 202 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,201,954 Number of Sequences: 28952 Number of extensions: 284808 Number of successful extensions: 549 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 549 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1804564000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -