BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0472.Seq (657 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 1.3 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 2.2 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 22 5.1 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/20 (50%), Positives = 11/20 (55%), Gaps = 1/20 (5%) Frame = -2 Query: 593 WTTG-FWWWVTAPTSRAWTT 537 WTT WW + TS WTT Sbjct: 1035 WTTKPSTWWSSTTTSPWWTT 1054 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.0 bits (47), Expect = 2.2 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -3 Query: 145 DLPTLSITVR-GSEEGRXHRMFMSKLRLINNF 53 D P L TV G EEG+ H + +S L+ + Sbjct: 1041 DKPYLFETVEFGREEGKEHHLKISNLKTYTQY 1072 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = +3 Query: 111 LPRTVIDNVGRSSPLAY*RTEANVYSPXPD 200 LP+ ++DN+ + + E N+++P D Sbjct: 508 LPQWILDNIYDQLIMPRIQAEVNIWNPLTD 537 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,378 Number of Sequences: 336 Number of extensions: 2353 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -