BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0467.Seq (752 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 2.0 DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory pro... 23 2.6 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 8.0 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 8.0 AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical pro... 21 8.0 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 8.0 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +1 Query: 277 GAKVKSVCTFEGNTLKQVQKAPDG 348 G C FEGN +K + DG Sbjct: 342 GRPATFTCNFEGNPIKTISWLKDG 365 >DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory protein 17 protein. Length = 124 Score = 23.0 bits (47), Expect = 2.6 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 232 DEVQARRRFEEDRADGAKVKSVCTFEGNTLKQVQKAPDGLE 354 DE+ R ++ D K CT EG LK + PD L+ Sbjct: 30 DEILKNDRLTKNYLDCILEKGKCTPEGEELK--KDIPDALQ 68 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 479 PPIHEHPAAQYVY 517 PP++ PA QY Y Sbjct: 162 PPMYPFPAGQYPY 174 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 479 PPIHEHPAAQYVY 517 PP++ PA QY Y Sbjct: 54 PPMYPFPAGQYPY 66 >AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical protein protein. Length = 86 Score = 21.4 bits (43), Expect = 8.0 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +2 Query: 692 CIQKYVIGYIK 724 C+ +VIGY+K Sbjct: 37 CVSPFVIGYVK 47 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.4 bits (43), Expect = 8.0 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = -3 Query: 222 LKVEEVTKLYSSPSLRSSTVGVTALAALRVIRPTPMVFMNSSKFSEEVI 76 L+ ++ L SS S + L +VIR TP+V + S+ + +++ Sbjct: 353 LRFGKILLLVSSTFRTISGRTIEDLFFKKVIRDTPIVAIISNMYKNQIL 401 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,928 Number of Sequences: 336 Number of extensions: 2929 Number of successful extensions: 15 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -