BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0460.Seq (889 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual 28 2.0 SPBC19G7.05c |bgs1|cps1, drc1|1,3-beta-glucan synthase catalytic... 27 2.7 SPAC30D11.02c |||sequence orphan|Schizosaccharomyces pombe|chr 1... 27 2.7 SPAC24C9.07c |bgs2|meu21, pgs2|1,3-beta-glucan synthase subunit ... 27 3.6 SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit ... 27 4.7 SPAC29B12.14c |||purine transporter |Schizosaccharomyces pombe|c... 26 6.2 SPBC16A3.12c |||triglyceride lipase-cholesterol esterase |Schizo... 26 8.2 >SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual Length = 4717 Score = 27.9 bits (59), Expect = 2.0 Identities = 11/44 (25%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +1 Query: 175 FLSLFHTAFSATQHRSYLRITSQEFTTYHWILSSKLW-SVCLLS 303 F+ +F FS+ ++ ++ + S + W K+W C LS Sbjct: 529 FIDIFEQTFSSKKNAKFISMASTSARRFRWKTCLKIWKEACKLS 572 >SPBC19G7.05c |bgs1|cps1, drc1|1,3-beta-glucan synthase catalytic subunit Bgs1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1729 Score = 27.5 bits (58), Expect = 2.7 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 47 TLMQHCIAVFVNNLLQFAFYSF*VVIRVYITWL 145 TL CI+ F+ N QFA+ F V R ++ WL Sbjct: 1356 TLTALCISPFLYNPHQFAWTDFFVDYREFMRWL 1388 >SPAC30D11.02c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 85 Score = 27.5 bits (58), Expect = 2.7 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -3 Query: 134 CTL**QLKMNKMQIVINYLQIQQYNAASMCLIYKIATHYK 15 C L L+ NK ++I YL I+ ++A MC+ + + + K Sbjct: 46 CLLNFSLRENKNYLIIVYLPIEGFSANHMCISHGTSFNIK 85 >SPAC24C9.07c |bgs2|meu21, pgs2|1,3-beta-glucan synthase subunit Bgs2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1894 Score = 27.1 bits (57), Expect = 3.6 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 32 FYKLDTLMQHCIAVFVNNLLQFAFYSF*VVIRVYITWL 145 ++ + TL CI+ F+ N QF++ F V R +I WL Sbjct: 1510 YFWISTLAM-CISPFIFNPHQFSWTDFFVDYREFIRWL 1546 >SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit Bgs4|Schizosaccharomyces pombe|chr 3|||Manual Length = 1955 Score = 26.6 bits (56), Expect = 4.7 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 47 TLMQHCIAVFVNNLLQFAFYSF*VVIRVYITWL 145 ++M C+A F+ N QF + F V R +I WL Sbjct: 1540 SIMALCVAPFLFNPHQFDWNDFFVDYREFIRWL 1572 >SPAC29B12.14c |||purine transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 581 Score = 26.2 bits (55), Expect = 6.2 Identities = 11/57 (19%), Positives = 28/57 (49%) Frame = +3 Query: 156 SYCDHWFSFVIPYSFLSYTTSIIFEDHVTRVYHLPLDIVIQAVVSLFAVMWGVLNVA 326 S+ + W + + Y+ ++ +I VYH+ ++ ++ ++ +W +LN A Sbjct: 85 SWWEAWITVWVGYTIAAFILTIA--GRAGAVYHISFPVLSRSSFGIWGSLWPILNRA 139 >SPBC16A3.12c |||triglyceride lipase-cholesterol esterase |Schizosaccharomyces pombe|chr 2|||Manual Length = 443 Score = 25.8 bits (54), Expect = 8.2 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -3 Query: 326 RHIQHSPHDSKQTDHSLDDNIQW*VVNSCDVILK 225 +HI + P D + + SLDD + + ++ D IL+ Sbjct: 164 KHITYKPKDEEFWNFSLDDMAMFDIPDTVDYILR 197 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,259,009 Number of Sequences: 5004 Number of extensions: 62774 Number of successful extensions: 131 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 131 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 446488370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -