BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0460.Seq (889 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0802 + 23313763-23313835,23314100-23314152,23314651-233147... 39 0.006 >12_02_0802 + 23313763-23313835,23314100-23314152,23314651-23314751, 23315970-23316063 Length = 106 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/62 (37%), Positives = 32/62 (51%) Frame = +3 Query: 258 PLDIVIQAVVSLFAVMWGVLNVAGNLREIPAAAELNAIKWETQNNLPSFYIFNHRGKALS 437 P+D+++Q ++ L MW L V + +E N I NL F IFNHRG+AL Sbjct: 40 PMDVMMQLLLGLALCMWAGLAVPAKFLSVLPHSEENRIV-SLPANL-DFMIFNHRGRALP 97 Query: 438 YD 443 D Sbjct: 98 SD 99 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/33 (36%), Positives = 23/33 (69%) Frame = +1 Query: 157 VIVIIGFLSLFHTAFSATQHRSYLRITSQEFTT 255 V+ ++G L H A++ Q+R+ L+IT +EF++ Sbjct: 6 VLGVLGGALLAHAAYATIQYRAVLKITEEEFSS 38 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,465,140 Number of Sequences: 37544 Number of extensions: 357011 Number of successful extensions: 760 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 759 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2495239620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -