BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0460.Seq (889 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g03345.1 68418.m00287 expressed protein 38 0.009 >At5g03345.1 68418.m00287 expressed protein Length = 104 Score = 37.9 bits (84), Expect = 0.009 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 1/80 (1%) Frame = +3 Query: 192 YSFLSYTTSI-IFEDHVTRVYHLPLDIVIQAVVSLFAVMWGVLNVAGNLREIPAAAELNA 368 YS + Y + I E+ +R P++++++ ++ L MW L G I ++ N Sbjct: 20 YSTIQYRGLLKIMEEEFSRP---PINVILELIIGLALCMWAALTFPGKFLSIHPDSDENR 76 Query: 369 IKWETQNNLPSFYIFNHRGK 428 + N+ F IFNHRG+ Sbjct: 77 AVFLPDNS--DFMIFNHRGR 94 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 157 VIVIIGFLSLFHTAFSATQHRSYLRITSQEFT 252 ++ + G L L H A+S Q+R L+I +EF+ Sbjct: 6 LVGVFGVLILSHAAYSTIQYRGLLKIMEEEFS 37 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,444,233 Number of Sequences: 28952 Number of extensions: 309108 Number of successful extensions: 590 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 590 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2081245872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -