BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0450.Seq (886 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 37 2e-04 AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 31 0.016 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 31 0.016 DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory pro... 22 5.6 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 5.6 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 22 5.6 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 37.1 bits (82), Expect = 2e-04 Identities = 14/19 (73%), Positives = 18/19 (94%) Frame = +1 Query: 1 LLQDFFNGKELNKSINPDE 57 L++DFF+GKELN+ INPDE Sbjct: 176 LIKDFFDGKELNRGINPDE 194 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 30.7 bits (66), Expect = 0.016 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +1 Query: 1 LLQDFFNGKELNKSINPDE 57 L+ ++FNGKE +SINPDE Sbjct: 177 LITEYFNGKEPCRSINPDE 195 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 30.7 bits (66), Expect = 0.016 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +1 Query: 1 LLQDFFNGKELNKSINPDE 57 L+ ++FNGKE +SINPDE Sbjct: 177 LITEYFNGKEPCRSINPDE 195 >DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory protein 5 protein. Length = 144 Score = 22.2 bits (45), Expect = 5.6 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 1 LLQDFFNGKELNKSINPDE 57 + DF NGK L++S D+ Sbjct: 15 IFSDFVNGKTLHRSTRDDK 33 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 22.2 bits (45), Expect = 5.6 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +3 Query: 330 FELTGIPPAPRGVPQIEVTFDIDANGILNVSAXEKSTNK 446 + G+ A V I+ D+D NG N + +K+ K Sbjct: 56 YSFIGVNDADWSVLVIDPELDVDQNGFRNFTNLKKTHPK 94 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 22.2 bits (45), Expect = 5.6 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = -3 Query: 587 RFQCILGPGWSPFAC 543 ++QC+ G GW+ C Sbjct: 120 QYQCLCGVGWTGKVC 134 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,847 Number of Sequences: 336 Number of extensions: 3360 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24513621 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -