BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0447.Seq (683 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 24 1.0 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 24 1.0 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 24.2 bits (50), Expect = 1.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 Query: 246 NYLREDQTQ*FKISTIYEVN*SRSNXSTG*WSY 344 NY+ E+Q FKIS +N + S WSY Sbjct: 19 NYMDENQALGFKISDNSGINSQMIDYSRPNWSY 51 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 24.2 bits (50), Expect = 1.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 Query: 246 NYLREDQTQ*FKISTIYEVN*SRSNXSTG*WSY 344 NY+ E+Q FKIS +N + S WSY Sbjct: 39 NYMDENQALGFKISDNSGINSQMIDYSRPNWSY 71 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,579 Number of Sequences: 336 Number of extensions: 2124 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -