Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ps4M0444.Seq
         (612 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    22   3.5  
EF468474-1|ABR25244.1|  516|Tribolium castaneum methoprene-toler...    21   8.2  

>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10
           protein.
          Length = 2700

 Score = 22.2 bits (45), Expect = 3.5
 Identities = 13/38 (34%), Positives = 20/38 (52%)
 Frame = +2

Query: 206 RASKIRKLFNLSKEDDDVVMSSNACSQPRKEKKMLNPD 319
           R S+I +     +EDD VV    A ++ RKE    +P+
Sbjct: 160 RHSEIVETVYDPREDDRVVCYVQAAARYRKEPLAFSPE 197


>EF468474-1|ABR25244.1|  516|Tribolium castaneum methoprene-tolerant
           protein.
          Length = 516

 Score = 21.0 bits (42), Expect = 8.2
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -3

Query: 265 HNDVIIFFAKV 233
           +NDV++FF KV
Sbjct: 224 NNDVLLFFVKV 234


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 117,773
Number of Sequences: 336
Number of extensions: 2179
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15561709
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)