BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0444.Seq (612 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 25 1.5 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 24 4.4 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 5.9 AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenin... 23 7.8 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 7.8 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 25.4 bits (53), Expect = 1.5 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = -1 Query: 180 FPSVNPGISWAPLRTITRAKTERLASXIHPR 88 +P + G + APLR+I + +++A+ +HPR Sbjct: 408 WPDLGVG-NMAPLRSIGLTELDQIAASMHPR 437 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.8 bits (49), Expect = 4.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 127 SCYCAQGCPGN 159 +CYC CPGN Sbjct: 73 TCYCEGHCPGN 83 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.4 bits (48), Expect = 5.9 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -2 Query: 197 LDGGVHFHQSIQEFPGH 147 +DGG++ S++ FPG+ Sbjct: 167 VDGGLNIPHSVKRFPGY 183 >AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenine transaminase protein. Length = 396 Score = 23.0 bits (47), Expect = 7.8 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 137 VRKGAQEIPGLTDGNVPRRLGPKRASKIRKLFNLSK 244 V GAQ++ G G P + PK IR SK Sbjct: 199 VYTGAQKVLGAPPGITPISISPKALDVIRNRRTKSK 234 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 7.8 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -2 Query: 122 RPRDWRXQYIHELIYVFXLHRGAVCNMSGPLTSEDEHG 9 +P+D+R + L VF +GA+ ++ T ED G Sbjct: 856 KPKDFRKHSLLPLNNVFDRIKGALPHLKKSPTKEDATG 893 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 532,699 Number of Sequences: 2352 Number of extensions: 9460 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59711994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -