BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0442.Seq (799 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 2.1 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 22 4.9 AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 22 6.5 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 22 6.5 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 23.4 bits (48), Expect = 2.1 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -3 Query: 419 SKLILPFLTGFSESLLLAFVPVFVEATSTVF 327 SKLI F F LLL F F+ T T+F Sbjct: 862 SKLIRLFNEIFGHGLLLMFGISFLLVTQTIF 892 Score = 22.6 bits (46), Expect = 3.7 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -3 Query: 419 SKLILPFLTGFSESLLLAFVPVFVEATSTVF 327 SKL+ F F LLL F F+ T T+F Sbjct: 586 SKLVTRFNEIFGLGLLLMFGVSFLLITQTIF 616 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 22.2 bits (45), Expect = 4.9 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -3 Query: 419 SKLILPFLTGFSESLLLAFVPVFVEATSTVFRHMLRPDSQK 297 SKL+ F F LLL F F+ T +F + S+K Sbjct: 230 SKLVTRFNEIFGLGLLLMFAVSFLIITQVIFVICVLVQSEK 270 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 21.8 bits (44), Expect = 6.5 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -3 Query: 413 LILPFLTGFSESLLLAFVPVFVEATSTVFRHMLRPD 306 L PFL L +FVP+ V A +F + + D Sbjct: 174 LFYPFLPSDVSYNLFSFVPLVVNALDHLFLNDILSD 209 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 21.8 bits (44), Expect = 6.5 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -3 Query: 413 LILPFLTGFSESLLLAFVPVFVEATSTVFRHMLRPD 306 L PFL L +FVP+ V A +F + + D Sbjct: 130 LFYPFLPSDVSYNLFSFVPLVVNALDHLFLNDILSD 165 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,291 Number of Sequences: 336 Number of extensions: 3662 Number of successful extensions: 20 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -