BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0439.Seq (908 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0588 - 20842209-20842337,20842464-20842560,20842620-208427... 33 0.31 03_02_0445 - 8551912-8552047,8552729-8552896,8553785-8554068,855... 30 2.9 12_01_0988 - 10039187-10039243,10039356-10039649,10039838-100402... 29 3.9 03_05_0478 - 24712157-24712177,24712206-24712260,24712377-247124... 29 5.1 09_06_0134 + 21065104-21065965,21066732-21066961,21067618-210678... 29 6.7 >12_02_0588 - 20842209-20842337,20842464-20842560,20842620-20842733, 20843140-20843749,20844739-20845462,20845542-20845620, 20845783-20845865,20846148-20846226,20846332-20846420, 20846499-20846591,20847288-20847337,20847417-20847600, 20849227-20849542,20849626-20849657 Length = 892 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +1 Query: 64 LPEIKVQDSLTKSLHFKSEKNSNSSKLDKTNSTKIV 171 +P++K++ + SLHFK N++K D TK+V Sbjct: 510 IPKVKIKGTKVPSLHFKDVGEENAAKSDTGKGTKLV 545 >03_02_0445 - 8551912-8552047,8552729-8552896,8553785-8554068, 8554143-8555386,8556901-8556967,8557059-8557150, 8557269-8557480,8558541-8558623,8559092-8559122, 8559770-8559951,8560557-8560616,8561092-8561289, 8561485-8561539,8562740-8562855,8563012-8563176, 8563310-8563483,8564134-8564333,8564778-8564882, 8565063-8565126,8566452-8566718 Length = 1300 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/56 (32%), Positives = 29/56 (51%) Frame = -2 Query: 430 VLEMTEDDKWPILISESREDLIEFSAFDFTLILLNASTRSLKLRSGVDSLDNDEGV 263 +L+M E KWPI+++ +++D L+L S +L S VD + EGV Sbjct: 621 ILKMVETTKWPIILTSNKKD-PPLPHLLAQLVLDFTYPSSAELLSHVDMICKSEGV 675 >12_01_0988 - 10039187-10039243,10039356-10039649,10039838-10040202, 10042916-10042931 Length = 243 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +1 Query: 19 LKDLVIPEVRGPIVDLPEIKVQ-DSLTKSLHFKSEKNSNSSKLDKT 153 +KD + PEV G I+D +IK ++ +S F E ++N+ K + T Sbjct: 87 VKDAISPEVIGGIIDSNDIKTYLANIEESFEFAPEAHANTLKEEWT 132 >03_05_0478 - 24712157-24712177,24712206-24712260,24712377-24712473, 24712558-24713302,24713822-24714189,24714279-24714419, 24715480-24715849 Length = 598 Score = 29.1 bits (62), Expect = 5.1 Identities = 19/61 (31%), Positives = 36/61 (59%) Frame = +3 Query: 279 SKESTPERNFNERVEAFNKINVKSNALNSMRSSLDSDIRIGHLSSSVISRTLSNATDYMK 458 S +S +R NE++ +K+ V S+A+ +R D+D+ + + SSSV+ L +A + + Sbjct: 383 SLQSDIDRFINEKIVVADKVIV-SHAITKVR---DNDVLLTYGSSSVVEMILDHAHELGR 438 Query: 459 K 461 K Sbjct: 439 K 439 >09_06_0134 + 21065104-21065965,21066732-21066961,21067618-21067841, 21067929-21068781 Length = 722 Score = 28.7 bits (61), Expect = 6.7 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 3/70 (4%) Frame = +3 Query: 330 NKINVKSNALN-SMRSSLDSDI--RIGHLSSSVISRTLSNATDYMKKDYKEVINYAREFK 500 +++ SN+L+ + +S SDI G + S S+TL + KK Y+EV + + Sbjct: 312 SELGASSNSLSWTDKSETKSDIFDDYGGMKSGSHSQTLGRLYAWEKKLYEEVKAIDQIRQ 371 Query: 501 NVELKCVLLR 530 E KCV LR Sbjct: 372 TYEKKCVQLR 381 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,328,928 Number of Sequences: 37544 Number of extensions: 432711 Number of successful extensions: 965 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 929 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 965 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2577242800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -