BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0438.Seq (512 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 26 0.26 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 23 2.4 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 23 2.4 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 23 2.4 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 23 2.4 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 23 2.4 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 23 2.4 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 23 2.4 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 23 2.4 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 23 2.4 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 23 2.4 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 23 2.4 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 21 7.5 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 7.5 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 7.5 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 9.9 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 25.8 bits (54), Expect = 0.26 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = -1 Query: 362 HSCRSEPVYLVSYDFSCTPCE-DPGSQR-YRTPTRNP 258 HSC + P + S D+ T C DPG R + P + P Sbjct: 277 HSCEACPAHSKSSDYGFTECRCDPGYFRAEKDPKKMP 313 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.6 bits (46), Expect = 2.4 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 290 ILDPRMVCKKNRRTRGRLAQICRNE 364 +L+ R CK+ R+R R ++ +NE Sbjct: 29 LLEERTSCKRYSRSREREQKLYKNE 53 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.6 bits (46), Expect = 2.4 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 290 ILDPRMVCKKNRRTRGRLAQICRNE 364 +L+ R CK+ R+R R ++ +NE Sbjct: 29 LLEERTSCKRYSRSREREQKLYKNE 53 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.6 bits (46), Expect = 2.4 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 290 ILDPRMVCKKNRRTRGRLAQICRNE 364 +L+ R CK+ R+R R ++ +NE Sbjct: 29 LLEERTSCKRYSRSREREQKLYKNE 53 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.6 bits (46), Expect = 2.4 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 290 ILDPRMVCKKNRRTRGRLAQICRNE 364 +L+ R CK+ R+R R ++ +NE Sbjct: 29 LLEERTSCKRYSRSREREQKLYKNE 53 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.6 bits (46), Expect = 2.4 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 290 ILDPRMVCKKNRRTRGRLAQICRNE 364 +L+ R CK+ R+R R ++ +NE Sbjct: 262 LLEERTSCKRYSRSREREQKLYKNE 286 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.4 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 290 ILDPRMVCKKNRRTRGRLAQICRNE 364 +L+ R CK+ R+R R ++ +NE Sbjct: 262 LLEERTSCKRYSRSREREQKLYKNE 286 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.4 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 290 ILDPRMVCKKNRRTRGRLAQICRNE 364 +L+ R CK+ R+R R ++ +NE Sbjct: 262 LLEERTSCKRYSRSREREQKLYKNE 286 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.4 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 290 ILDPRMVCKKNRRTRGRLAQICRNE 364 +L+ R CK+ R+R R ++ +NE Sbjct: 262 LLEERTSCKRYSRSREREQKLYKNE 286 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.4 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 290 ILDPRMVCKKNRRTRGRLAQICRNE 364 +L+ R CK+ R+R R ++ +NE Sbjct: 262 LLEERTSCKRYSRSREREQKLYKNE 286 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.6 bits (46), Expect = 2.4 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 290 ILDPRMVCKKNRRTRGRLAQICRNE 364 +L+ R CK+ R+R R ++ +NE Sbjct: 251 LLEERTSCKRYSRSREREQKLYKNE 275 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 22.6 bits (46), Expect = 2.4 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = -2 Query: 253 GARSSRQAAITTGRISCQTSLPFIYN--HNRT 164 G+ RQAAI +G + PF + HN+T Sbjct: 49 GSDEKRQAAIQSGEYDYTKNYPFDVDQWHNKT 80 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 287 VILDPRMVCKKNRRT 331 VILDP+++ K RT Sbjct: 153 VILDPKLIAKHYLRT 167 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 287 VILDPRMVCKKNRRT 331 VILDP+++ K RT Sbjct: 153 VILDPKLIAKHYLRT 167 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 287 VILDPRMVCKKNRRT 331 VILDP+++ K RT Sbjct: 153 VILDPKLIAKHYLRT 167 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 20.6 bits (41), Expect = 9.9 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -2 Query: 253 GARSSRQAAITTGRISCQTSLPF 185 G+ RQAAI +G + PF Sbjct: 46 GSEERRQAAIQSGEYDHTKNYPF 68 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,489 Number of Sequences: 438 Number of extensions: 2576 Number of successful extensions: 16 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14232156 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -