BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0437.Seq (901 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3112| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_11096| Best HMM Match : Fz (HMM E-Value=0.00044) 31 1.3 >SB_3112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/56 (32%), Positives = 29/56 (51%) Frame = +1 Query: 322 YPEWNFFVIPHGRCRWTPRPSLLAARTQSPRATRANRSRSPQATDRRLVRFVPTRE 489 Y W F +GRC WTP + + ++S +R++R + D+ V +PTRE Sbjct: 87 YRRWKLF---YGRCSWTPAGLVRSVTSKSIPMSRSSRYPCHKHVDQSDV-VLPTRE 138 >SB_11096| Best HMM Match : Fz (HMM E-Value=0.00044) Length = 918 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +1 Query: 109 TYGSDVVSFTEMEPEERVDPMARVFPKVTKCTFHKYGPSGTCRNSTACVF 258 TY VSFT+ +D + +F +T C FH + TCR +F Sbjct: 334 TYSITQVSFTDKRTYTVMDSRSILFALMTICCFHAIEATQTCRPMEDTIF 383 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,130,421 Number of Sequences: 59808 Number of extensions: 501488 Number of successful extensions: 1493 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1474 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2586032617 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -