BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0437.Seq (901 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 27 0.59 Z22930-1|CAA80513.1| 273|Anopheles gambiae trypsin-related prot... 26 1.8 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 27.5 bits (58), Expect = 0.59 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -3 Query: 236 LHVPDGPYLWKVHLVTLGNTLAIGSTRSSGSISVKLTTS 120 +H D PYLW V +T+ L R+ + V+L T+ Sbjct: 455 MHADDIPYLWSVTDLTISPILPTNHARTVSNRFVRLFTN 493 >Z22930-1|CAA80513.1| 273|Anopheles gambiae trypsin-related protease protein. Length = 273 Score = 25.8 bits (54), Expect = 1.8 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 199 CTFHKYGPSGTCRNSTACVFAIE 267 C +K G +GTCRN + F E Sbjct: 213 CAGYKQGGTGTCRNDSGGPFVAE 235 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 840,193 Number of Sequences: 2352 Number of extensions: 15502 Number of successful extensions: 32 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97160985 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -