BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0436.Seq (904 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U88315-16|AAK68237.1| 414|Caenorhabditis elegans Hypothetical p... 29 3.4 AF106579-8|AAC78201.1| 710|Caenorhabditis elegans Hypothetical ... 28 7.9 >U88315-16|AAK68237.1| 414|Caenorhabditis elegans Hypothetical protein C37H5.13a protein. Length = 414 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -3 Query: 560 DDPRLHLVTAAHSSDTRLI 504 DDPRLHL AA+ SD +I Sbjct: 309 DDPRLHLAAAAYISDATMI 327 >AF106579-8|AAC78201.1| 710|Caenorhabditis elegans Hypothetical protein F54E2.5 protein. Length = 710 Score = 28.3 bits (60), Expect = 7.9 Identities = 14/52 (26%), Positives = 31/52 (59%) Frame = +3 Query: 87 LFFYETATICSAFDNTVLFVKEISLSSLVIKGKVELWQEQRKYRRNQRQPLF 242 +FF+ +T +AF + V+F+ +S+ L + ++ L KYR +++ P++ Sbjct: 130 VFFFRHSTD-TAFSSPVIFIWLVSVWVLALIVEIILMTSNCKYRHDKKTPVY 180 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,928,444 Number of Sequences: 27780 Number of extensions: 353970 Number of successful extensions: 920 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 899 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 920 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2297313942 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -