BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0435.Seq (585 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1778.04 |spo6||Spo4-Spo6 kinase complex regulatory subunit S... 28 0.87 SPBC947.04 |||DIPSY family|Schizosaccharomyces pombe|chr 2|||Manual 25 6.2 >SPBC1778.04 |spo6||Spo4-Spo6 kinase complex regulatory subunit Spo6|Schizosaccharomyces pombe|chr 2|||Manual Length = 474 Score = 28.3 bits (60), Expect = 0.87 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = -3 Query: 322 MSKVINLKIYLINQEITKYLFV*IYKKDLIIIS*SCTLTRAESSQNY 182 +SK N+KI+L+++ + + LF + L+ S SC + + + Y Sbjct: 187 LSKTANMKIWLLDKLLNRILFTLLNSDSLVNTSASCLQSLLDGEKVY 233 >SPBC947.04 |||DIPSY family|Schizosaccharomyces pombe|chr 2|||Manual Length = 973 Score = 25.4 bits (53), Expect = 6.2 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +1 Query: 4 NSHVSSNLLNYRDSTTFSIEIISPKYSCKKGLF 102 N +S + L YR+S F I +P + +G+F Sbjct: 848 NDSISPSYLTYRESDGFGIASSNPSPAGSEGIF 880 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,883,005 Number of Sequences: 5004 Number of extensions: 32673 Number of successful extensions: 55 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 252150250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -