BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0435.Seq (585 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0613 - 25509044-25509118,25509256-25511275,25511632-25512467 27 8.3 03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655,904... 27 8.3 >11_06_0613 - 25509044-25509118,25509256-25511275,25511632-25512467 Length = 976 Score = 27.5 bits (58), Expect = 8.3 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = -3 Query: 541 NCTFTDIYTIKLSSXIILVQSAKM*NSCNTKLPHDFIKLEMIQ 413 NC F + Y +K + ++ ++ C TKLP++ L+ +Q Sbjct: 597 NCHFEESYHLKHLGNLFHLRYLRLHCGCITKLPNEIGNLQFLQ 639 >03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655, 9041608-9041802,9041905-9042153,9042525-9042672, 9042673-9042779,9043311-9043475,9044506-9045948 Length = 1273 Score = 27.5 bits (58), Expect = 8.3 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 1 VNSHVSSNLLNYRDSTTFSIEIISP 75 V S SSNLLN +D +F +E + P Sbjct: 493 VGSVTSSNLLNPQDDLSFKLEYVHP 517 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,095,152 Number of Sequences: 37544 Number of extensions: 149145 Number of successful extensions: 172 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 170 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 172 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1376330256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -