BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0435.Seq (585 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3203| Best HMM Match : FGF (HMM E-Value=0.013) 29 2.1 SB_43314| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 >SB_3203| Best HMM Match : FGF (HMM E-Value=0.013) Length = 423 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 534 HSQTYILLNCHQX*YLFSQQRCKIHVILNYH 442 H + YI LN H Y+ + CK+++ LN H Sbjct: 158 HGKMYIRLNRHGKMYIRLNRHCKMYIRLNRH 188 >SB_43314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 326 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 1 VNSHVSSNLLNYRDSTTFSIEIISPKYSCKKGLF*EMI 114 +NS + + LN++ ST E++ K S G F + I Sbjct: 191 INSEIRTTFLNFKPSTIADFELLREKLSLLNGTFHQYI 228 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,689,489 Number of Sequences: 59808 Number of extensions: 195863 Number of successful extensions: 206 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 198 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 206 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1410146228 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -