BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0433.Seq (827 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26200.1 68415.m03146 expressed protein 31 0.71 At3g55190.1 68416.m06130 esterase/lipase/thioesterase family pro... 29 3.8 At3g25680.1 68416.m03196 expressed protein 29 3.8 At4g02570.1 68417.m00351 cullin family protein similar to cullin... 29 5.0 At4g19530.1 68417.m02873 disease resistance protein (TIR-NBS-LRR... 28 8.7 At3g42110.1 68416.m04323 hypothetical protein 28 8.7 >At2g26200.1 68415.m03146 expressed protein Length = 565 Score = 31.5 bits (68), Expect = 0.71 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 1/73 (1%) Frame = -1 Query: 485 RQNNMVVATKDNLKMXQMMDDVEMMIREGILTGKIERRDGTVISLKKSEDIENLARLVLG 306 R N+VVAT + K ++ + M + L GK++ +V+ E IE++ RL Sbjct: 397 RSANLVVATDADTKALTLLTENITMNLQSSLLGKLKT---SVLEWGNKEHIESIKRLACE 453 Query: 305 GLEIV-GDDAKVI 270 G E++ G D + Sbjct: 454 GFEVIMGTDVTYV 466 >At3g55190.1 68416.m06130 esterase/lipase/thioesterase family protein similar to monoglyceride lipase from [Homo sapiens] GI:14594904, [Mus musculus] GI:2632162; contains Interpro entry IPR000379 Length = 319 Score = 29.1 bits (62), Expect = 3.8 Identities = 12/40 (30%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -3 Query: 120 TVFKNMLPKYTREQFSFPGVKVE-KITTDELVTFVDEYDM 4 T FK++ PK+ +E F+ G++ E + L ++D +D+ Sbjct: 51 TTFKDIAPKFAKEGFAVHGIEYEGHGRSSGLSVYIDNFDL 90 >At3g25680.1 68416.m03196 expressed protein Length = 558 Score = 29.1 bits (62), Expect = 3.8 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = -1 Query: 128 TSSPFSRTCSRNILANSSASPESKWRKLPPMSWSHSL 18 TSS S SRN L NS+ +PES +L ++W L Sbjct: 265 TSSKLSGEDSRNDLGNSNFNPESFVSRLDLVNWKAQL 301 >At4g02570.1 68417.m00351 cullin family protein similar to cullin 3 [Homo sapiens] GI:3639052; contains Pfam profile PF00888: Cullin family Length = 738 Score = 28.7 bits (61), Expect = 5.0 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 7/71 (9%) Frame = +1 Query: 76 ELFASIFREHVLENGEDVANSFHDHPEDRIAETGSVHVQG------SRHVGVLVHVVLAI 237 E A+IF++HV G + D +++A T SV Q H +V+V Sbjct: 298 EPVANIFKQHVTAEGNALVQQAEDTATNQVANTASVQEQVLIRKVIELHDKYMVYVTECF 357 Query: 238 AQHFL-HKLVK 267 H L HK +K Sbjct: 358 QNHTLFHKALK 368 >At4g19530.1 68417.m02873 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1167 Score = 27.9 bits (59), Expect = 8.7 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +1 Query: 4 HVVLINECDQLIGGNFL-HFDSGEAELFASIFREHVLENGEDVANSFHDHPEDRIA 168 H V +N + NF+ H D ++F + +E GE++ N F + + RIA Sbjct: 15 HQVFLNFRGDELRNNFVSHLDKALRGKQINVFIDEAVEKGENLDNLFKEIEKSRIA 70 >At3g42110.1 68416.m04323 hypothetical protein Length = 448 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/51 (23%), Positives = 28/51 (54%) Frame = +2 Query: 119 VKMLQTRFMIIQKTGSRRQVVYMSKEVGT*VYLSMLYWP*LSIFFTSWSSG 271 VK+L + QKTG ++++ +++ T Y +WP ++ ++++G Sbjct: 22 VKVLHSWKQYTQKTGETLELIFSDEQIFTLNYAGGQFWPTNHLYKMTFTNG 72 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,313,837 Number of Sequences: 28952 Number of extensions: 349868 Number of successful extensions: 849 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 831 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 849 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1902108000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -