BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0424.Seq (626 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY333285-1|AAR03490.1| 1943|Homo sapiens truncated transient rec... 31 4.4 AY333284-1|AAR03489.1| 2017|Homo sapiens transient receptor pote... 31 4.4 AY333283-1|AAR03488.1| 2017|Homo sapiens transient receptor pote... 31 4.4 AY333282-1|AAR03487.1| 2022|Homo sapiens transient receptor pote... 31 4.4 AL354795-2|CAH70894.1| 2022|Homo sapiens transient receptor pote... 31 4.4 AL354795-1|CAH70893.1| 1133|Homo sapiens transient receptor pote... 31 4.4 AK026281-1|BAB15429.1| 1133|Homo sapiens protein ( Homo sapiens ... 31 4.4 AF448232-1|AAM21562.1| 2022|Homo sapiens LTRPC6 channel kinase 2... 31 4.4 AF350881-1|AAK31202.2| 2022|Homo sapiens channel-kinase 2 protein. 31 4.4 M73780-1|AAA36034.1| 769|Homo sapiens integrin beta-8 subunit p... 30 5.8 AC004130-1|AAQ96845.1| 769|Homo sapiens unknown protein. 30 5.8 >AY333285-1|AAR03490.1| 1943|Homo sapiens truncated transient receptor potential cation channel subfamily M member 6 vari protein. Length = 1943 Score = 30.7 bits (66), Expect = 4.4 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +3 Query: 495 RFRQEKLNVVNT--ETNISQTEIKVTELTQELKPVNEKLSAIK 617 ++ EK+ VN E I T +VTE+ +LK +NEK+S IK Sbjct: 1156 KYFHEKMEDVNCSCEERIRVTSERVTEMYFQLKEMNEKVSFIK 1198 >AY333284-1|AAR03489.1| 2017|Homo sapiens transient receptor potential cation channel subfamily M member 6 variant c protein. Length = 2017 Score = 30.7 bits (66), Expect = 4.4 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +3 Query: 495 RFRQEKLNVVNT--ETNISQTEIKVTELTQELKPVNEKLSAIK 617 ++ EK+ VN E I T +VTE+ +LK +NEK+S IK Sbjct: 1151 KYFHEKMEDVNCSCEERIRVTSERVTEMYFQLKEMNEKVSFIK 1193 >AY333283-1|AAR03488.1| 2017|Homo sapiens transient receptor potential cation channel subfamily M member 6 variant b protein. Length = 2017 Score = 30.7 bits (66), Expect = 4.4 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +3 Query: 495 RFRQEKLNVVNT--ETNISQTEIKVTELTQELKPVNEKLSAIK 617 ++ EK+ VN E I T +VTE+ +LK +NEK+S IK Sbjct: 1151 KYFHEKMEDVNCSCEERIRVTSERVTEMYFQLKEMNEKVSFIK 1193 >AY333282-1|AAR03487.1| 2022|Homo sapiens transient receptor potential cation channel subfamily M member 6 variant a protein. Length = 2022 Score = 30.7 bits (66), Expect = 4.4 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +3 Query: 495 RFRQEKLNVVNT--ETNISQTEIKVTELTQELKPVNEKLSAIK 617 ++ EK+ VN E I T +VTE+ +LK +NEK+S IK Sbjct: 1156 KYFHEKMEDVNCSCEERIRVTSERVTEMYFQLKEMNEKVSFIK 1198 >AL354795-2|CAH70894.1| 2022|Homo sapiens transient receptor potential cation channel, subfamily M, member 6 protein. Length = 2022 Score = 30.7 bits (66), Expect = 4.4 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +3 Query: 495 RFRQEKLNVVNT--ETNISQTEIKVTELTQELKPVNEKLSAIK 617 ++ EK+ VN E I T +VTE+ +LK +NEK+S IK Sbjct: 1156 KYFHEKMEDVNCSCEERIRVTSERVTEMYFQLKEMNEKVSFIK 1198 >AL354795-1|CAH70893.1| 1133|Homo sapiens transient receptor potential cation channel, subfamily M, member 6 protein. Length = 1133 Score = 30.7 bits (66), Expect = 4.4 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +3 Query: 495 RFRQEKLNVVNT--ETNISQTEIKVTELTQELKPVNEKLSAIK 617 ++ EK+ VN E I T +VTE+ +LK +NEK+S IK Sbjct: 819 KYFHEKMEDVNCSCEERIRVTSERVTEMYFQLKEMNEKVSFIK 861 >AK026281-1|BAB15429.1| 1133|Homo sapiens protein ( Homo sapiens cDNA: FLJ22628 fis, clone HSI06177. ). Length = 1133 Score = 30.7 bits (66), Expect = 4.4 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +3 Query: 495 RFRQEKLNVVNT--ETNISQTEIKVTELTQELKPVNEKLSAIK 617 ++ EK+ VN E I T +VTE+ +LK +NEK+S IK Sbjct: 819 KYFHEKMEDVNCSCEERIRVTSERVTEMYFQLKEMNEKVSFIK 861 >AF448232-1|AAM21562.1| 2022|Homo sapiens LTRPC6 channel kinase 2 protein. Length = 2022 Score = 30.7 bits (66), Expect = 4.4 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +3 Query: 495 RFRQEKLNVVNT--ETNISQTEIKVTELTQELKPVNEKLSAIK 617 ++ EK+ VN E I T +VTE+ +LK +NEK+S IK Sbjct: 1156 KYFHEKMEDVNCSCEERIRVTSERVTEMYFQLKEMNEKVSFIK 1198 >AF350881-1|AAK31202.2| 2022|Homo sapiens channel-kinase 2 protein. Length = 2022 Score = 30.7 bits (66), Expect = 4.4 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +3 Query: 495 RFRQEKLNVVNT--ETNISQTEIKVTELTQELKPVNEKLSAIK 617 ++ EK+ VN E I T +VTE+ +LK +NEK+S IK Sbjct: 1156 KYFHEKMEDVNCSCEERIRVTSERVTEMYFQLKEMNEKVSFIK 1198 >M73780-1|AAA36034.1| 769|Homo sapiens integrin beta-8 subunit protein. Length = 769 Score = 30.3 bits (65), Expect = 5.8 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 Query: 298 SCICAPRCRCTHPRCTDTFAEH 233 +C+C RC CT PR F EH Sbjct: 606 TCVCG-RCECTDPRSIGRFCEH 626 >AC004130-1|AAQ96845.1| 769|Homo sapiens unknown protein. Length = 769 Score = 30.3 bits (65), Expect = 5.8 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 Query: 298 SCICAPRCRCTHPRCTDTFAEH 233 +C+C RC CT PR F EH Sbjct: 606 TCVCG-RCECTDPRSIGRFCEH 626 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,882,524 Number of Sequences: 237096 Number of extensions: 1599348 Number of successful extensions: 2878 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2801 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2878 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6804036910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -