BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0424.Seq (626 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g38490.1 68415.m04728 CBL-interacting protein kinase 22, puta... 30 1.1 At1g63110.3 68414.m07131 cell division cycle protein-related con... 28 5.8 At1g63110.2 68414.m07132 cell division cycle protein-related con... 28 5.8 At1g63110.1 68414.m07130 cell division cycle protein-related con... 28 5.8 >At2g38490.1 68415.m04728 CBL-interacting protein kinase 22, putative (CIPK22) identical to CBL-interacting protein kinase 22 [Arabidopsis thaliana] gi|17902248|gb|AAL47845 Length = 455 Score = 30.3 bits (65), Expect = 1.1 Identities = 26/79 (32%), Positives = 34/79 (43%), Gaps = 4/79 (5%) Frame = +3 Query: 378 SNCSSL--KYLKCTHSDYEAS*ESRIVIFRHYLPVPGVGNLRFRQEKLNVVNTE--TNIS 545 SN S L ++ H D S ES VI R V NLR ++K + E ++ Sbjct: 344 SNLSGLFGNFVTPDHCDQFVSDESTAVIMRKVEEVAKQLNLRIAKKKERAIKLEGPHGVA 403 Query: 546 QTEIKVTELTQELKPVNEK 602 +KV LT EL V K Sbjct: 404 NVVVKVRRLTNELVMVEMK 422 >At1g63110.3 68414.m07131 cell division cycle protein-related contains 9 transmembrane domains; similar to PIG-U (GI:27372215) [Rattus norvegicus]; similar to Cell division cycle protein 91-like 1 (CDC91-like 1 protein) (PIG-U) (Swiss-Prot:Q9H490) [Homo sapiens] Length = 407 Score = 27.9 bits (59), Expect = 5.8 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = -2 Query: 619 VLIALNFSLTGFNSCVSSVTFISVWEIFVSVLTTLSFS 506 + +A++ L + S S ++S+W +FV+ L + FS Sbjct: 297 IYLAISSILKSYPSVGDSALYLSLWALFVNELLDMKFS 334 >At1g63110.2 68414.m07132 cell division cycle protein-related contains 9 transmembrane domains; similar to PIG-U (GI:27372215) [Rattus norvegicus]; similar to Cell division cycle protein 91-like 1 (CDC91-like 1 protein) (PIG-U) (Swiss-Prot:Q9H490) [Homo sapiens] Length = 397 Score = 27.9 bits (59), Expect = 5.8 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = -2 Query: 619 VLIALNFSLTGFNSCVSSVTFISVWEIFVSVLTTLSFS 506 + +A++ L + S S ++S+W +FV+ L + FS Sbjct: 287 IYLAISSILKSYPSVGDSALYLSLWALFVNELLDMKFS 324 >At1g63110.1 68414.m07130 cell division cycle protein-related contains 9 transmembrane domains; similar to PIG-U (GI:27372215) [Rattus norvegicus]; similar to Cell division cycle protein 91-like 1 (CDC91-like 1 protein) (PIG-U) (Swiss-Prot:Q9H490) [Homo sapiens] Length = 469 Score = 27.9 bits (59), Expect = 5.8 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = -2 Query: 619 VLIALNFSLTGFNSCVSSVTFISVWEIFVSVLTTLSFS 506 + +A++ L + S S ++S+W +FV+ L + FS Sbjct: 359 IYLAISSILKSYPSVGDSALYLSLWALFVNELLDMKFS 396 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,994,590 Number of Sequences: 28952 Number of extensions: 234916 Number of successful extensions: 559 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 546 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 559 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -