BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0419.Seq (565 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo... 29 0.62 SPAC4A8.08c |vas1||mitochondrial valine-tRNA ligase Vas1|Schizos... 27 2.5 SPBC1105.07c |||nuclear pore associated protein Thp1-Sac3 comple... 26 3.3 SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk... 26 4.4 SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces ... 25 5.8 SPCC663.03 |pmd1||leptomycin efflux transporter Pmd1|Schizosacch... 25 5.8 SPAP27G11.16 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 7.7 >SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizosaccharomyces pombe|chr 3|||Manual Length = 979 Score = 28.7 bits (61), Expect = 0.62 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = -1 Query: 433 CLINFRW*F---LRLPWLSRVTGNQGSIPEREPEKRLP 329 C+IN W LRL +L + NQ S E++ EKR+P Sbjct: 271 CMINETWPVDRALRLQFLIQQRNNQSSNEEQKQEKRVP 308 >SPAC4A8.08c |vas1||mitochondrial valine-tRNA ligase Vas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 950 Score = 26.6 bits (56), Expect = 2.5 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -1 Query: 400 LPWLSRVTGNQGSIPEREPEKRLPHPRKAAGAQITHSRHGEVVTKN 263 +P +S V + IPER+ + L P + H EVV +N Sbjct: 757 VPCISGVMLHSKIIPERKNSEFLSFPTSQQECLLVHDNQAEVVVQN 802 >SPBC1105.07c |||nuclear pore associated protein Thp1-Sac3 complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 442 Score = 26.2 bits (55), Expect = 3.3 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 457 VLDHAICKSYPDSSKLTIRTRGPPSIGFDLIKALIP 564 ++D K Y + T+ + PS GF +I++L+P Sbjct: 391 LIDQGYIKGYIIHASSTLVLKKDPSFGFSVIESLMP 426 >SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 306 Score = 25.8 bits (54), Expect = 4.4 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 320 PWMW*PFLRLPLRNRTLIPRYP*QPW*SQKLPS 418 P MW P N+ + YP +PW S+ LPS Sbjct: 236 PSMWPELSTFPDWNKFIFHEYPPKPW-SEILPS 267 >SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 25.4 bits (53), Expect = 5.8 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +1 Query: 322 LDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 423 L ++ S+ P + PD P T+ V+ TT+E+ Sbjct: 422 LGLINTSEINQPANLPDEPTAETSNPVSATTVEA 455 >SPCC663.03 |pmd1||leptomycin efflux transporter Pmd1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1362 Score = 25.4 bits (53), Expect = 5.8 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -1 Query: 556 VLLLDQNQSTEGLASESLILMNLDNFCRSHGQVPATH 446 +LLLD+ S SE L+ LDN RS + H Sbjct: 588 ILLLDEATSALDSKSEVLVQKALDNASRSRTTIVIAH 624 >SPAP27G11.16 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 104 Score = 25.0 bits (52), Expect = 7.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 91 AAHKCNYELFNRNNFSIRYWSWNYR 165 AA KC +E FSI + S+N++ Sbjct: 73 AASKCEFEKIWSTTFSISFLSFNFK 97 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,098,700 Number of Sequences: 5004 Number of extensions: 41245 Number of successful extensions: 91 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 90 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 238029836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -