BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0419.Seq (565 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 23 6.9 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 23 6.9 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 23 6.9 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 23 6.9 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 23 6.9 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 23 6.9 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 23 6.9 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 23 6.9 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 23 6.9 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 23 6.9 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 23 6.9 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 23 6.9 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 23 6.9 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 23 6.9 AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 23 6.9 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 6.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 436 HLKDASPVLDHAICKSY 486 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 6.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 436 HLKDASPVLDHAICKSY 486 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 6.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 436 HLKDASPVLDHAICKSY 486 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 6.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 436 HLKDASPVLDHAICKSY 486 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 6.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 436 HLKDASPVLDHAICKSY 486 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 6.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 436 HLKDASPVLDHAICKSY 486 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 6.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 436 HLKDASPVLDHAICKSY 486 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 6.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 436 HLKDASPVLDHAICKSY 486 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 6.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 436 HLKDASPVLDHAICKSY 486 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 6.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 436 HLKDASPVLDHAICKSY 486 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 6.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 436 HLKDASPVLDHAICKSY 486 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 6.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 436 HLKDASPVLDHAICKSY 486 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 6.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 436 HLKDASPVLDHAICKSY 486 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 23.0 bits (47), Expect = 6.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 436 HLKDASPVLDHAICKSY 486 HLKDASP L K++ Sbjct: 449 HLKDASPFLQERAVKNF 465 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 23.0 bits (47), Expect = 6.9 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +1 Query: 280 PRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 423 P A S A +P LDV+ AP P + D P VT E+ +ES Sbjct: 283 PAATSAPLAFKVP-LDVLP---APFPGPSTDEPRTVTRKRTTESDVES 326 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 550,008 Number of Sequences: 2352 Number of extensions: 12041 Number of successful extensions: 57 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 57 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52983882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -