BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0415.Seq (900 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0991 - 8358309-8358338,8359115-8359393,8359964-8360092,836... 31 1.6 09_02_0036 + 3217163-3217584,3217752-3218322 30 2.2 >07_01_0991 - 8358309-8358338,8359115-8359393,8359964-8360092, 8360317-8360598,8361400-8361525,8363490-8363870 Length = 408 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/80 (23%), Positives = 35/80 (43%) Frame = +2 Query: 221 CRHKINITCILSFNVYRVKKKKKTRGGARYPIRPIVSRITIHWPSFYNVVTGKTLALPNL 400 C H ++T +L +K + +G + +P H +++ + +G + + Sbjct: 145 CGHDAHVTMLLGAAKLLQSRKDELKGTIKLVFQPAEEG---HAGAYHVLESGLLDDVSVI 201 Query: 401 IALQHIPLSPAGVIAKRPAP 460 L IP P GV+A RP P Sbjct: 202 FGLHVIPNLPVGVVASRPGP 221 >09_02_0036 + 3217163-3217584,3217752-3218322 Length = 330 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 335 ITIHWPSFYNVV-TGKTLALPNLIALQH 415 I+ W F N+V +G TL++PN + LQH Sbjct: 69 ISAGWSRFINLVQSGPTLSIPNYVLLQH 96 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,922,417 Number of Sequences: 37544 Number of extensions: 412434 Number of successful extensions: 806 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 794 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 806 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2542098580 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -