BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0412.Seq (839 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 26 0.43 AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory recept... 23 4.0 AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory recept... 23 4.0 AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory recept... 23 4.0 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 22 5.3 S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subu... 22 7.0 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 7.0 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 21 9.2 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 25.8 bits (54), Expect = 0.43 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = -1 Query: 731 W*KNRSRYMGEXVLSSISLCPQMVKGTILVVAKTNGENQKEMGLW 597 W + R +Y+ VL +S+ ++ GT+++V T K G+W Sbjct: 720 WERKRRQYLCP-VLLRVSILRNIIVGTLMMVLGTGCVRIKITGVW 763 >AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory receptor candidate 47 protein. Length = 387 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 315 YIIFLFRAIWLALSLLI 265 YII +R +WL+LS L+ Sbjct: 222 YIIAHYRVLWLSLSDLL 238 >AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory receptor candidate 26 protein. Length = 387 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 315 YIIFLFRAIWLALSLLI 265 YII +R +WL+LS L+ Sbjct: 222 YIIAHYRVLWLSLSDLL 238 >AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory receptor candidate 6 protein. Length = 387 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 315 YIIFLFRAIWLALSLLI 265 YII +R +WL+LS L+ Sbjct: 222 YIIAHYRVLWLSLSDLL 238 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 22.2 bits (45), Expect = 5.3 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 Query: 712 DIWGXPFYHQYL 677 D W P+Y+QYL Sbjct: 35 DPWYNPYYYQYL 46 >S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subunit protein. Length = 141 Score = 21.8 bits (44), Expect = 7.0 Identities = 9/42 (21%), Positives = 20/42 (47%) Frame = -2 Query: 211 ELISLMSYGMMVICFPTGIVFFIALIFIGTVSDIIGVRIVLG 86 + + M Y ++ I P+G++ I+ + + R+ LG Sbjct: 62 QFVRSMGYYLIQIYIPSGLIVIISWVSFWLNRNATPARVALG 103 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.8 bits (44), Expect = 7.0 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 81 TRATLKESACSPWP 40 TR TLK + SP+P Sbjct: 256 TRTTLKNNRASPYP 269 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 21.4 bits (43), Expect = 9.2 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 279 LSLLILFFSCIDFHY 235 L++ IL+F C + HY Sbjct: 327 LAIFILYFICDEAHY 341 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,946 Number of Sequences: 336 Number of extensions: 4622 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23140487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -