BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0412.Seq (839 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 25 2.2 Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. 25 2.9 AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1... 25 3.8 AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1... 25 3.8 AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1... 25 3.8 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 24 6.6 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 24 6.6 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 25.4 bits (53), Expect = 2.2 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 310 NIFHYITPVNTNLIKRPMLFPEHFI 384 N+FH+I V + PM+ +H+I Sbjct: 146 NVFHHIKQVRSQKPLLPMILDQHYI 170 >Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 25.0 bits (52), Expect = 2.9 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 5 ARRSFSGLPGPLGQGEHADSFSVARV 82 A RS S L PLG HA +V RV Sbjct: 91 AGRSTSSLTVPLGTSRHASGGTVVRV 116 >AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 24.6 bits (51), Expect = 3.8 Identities = 8/21 (38%), Positives = 16/21 (76%) Frame = -3 Query: 336 HRSDVMKYIIFLFRAIWLALS 274 HRSD++ ++FL++ I + +S Sbjct: 141 HRSDIVYGVLFLYQTIGIVMS 161 >AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 24.6 bits (51), Expect = 3.8 Identities = 8/21 (38%), Positives = 16/21 (76%) Frame = -3 Query: 336 HRSDVMKYIIFLFRAIWLALS 274 HRSD++ ++FL++ I + +S Sbjct: 141 HRSDIVYGVLFLYQTIGIVMS 161 >AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 24.6 bits (51), Expect = 3.8 Identities = 8/21 (38%), Positives = 16/21 (76%) Frame = -3 Query: 336 HRSDVMKYIIFLFRAIWLALS 274 HRSD++ ++FL++ I + +S Sbjct: 141 HRSDIVYGVLFLYQTIGIVMS 161 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.8 bits (49), Expect = 6.6 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = +3 Query: 540 TRSQRPAASFVSLLALPGPP*THLLLIL--PVGLGHHKYSXLYHLGTQR 680 T + AAS +SL + PP H L PVG G H L+H Q+ Sbjct: 782 TAAAMAAASPLSLSS-KAPPHPHSALSSHSPVGAGSHHLHHLHHHAAQQ 829 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.8 bits (49), Expect = 6.6 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -3 Query: 378 VLRK*HWTFY*ICIHRSDVMKYIIFLFRAIWL 283 V+RK +C ++D+ K++ L R +WL Sbjct: 361 VIRKSFHALRQLCASQADIPKWLGLLERTLWL 392 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 885,086 Number of Sequences: 2352 Number of extensions: 20502 Number of successful extensions: 45 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88891965 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -