BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0411.Seq (448 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024200-11|AAF36000.1| 271|Caenorhabditis elegans Hypothetical... 31 0.38 AF039047-9|AAB94228.1| 303|Caenorhabditis elegans Hypothetical ... 29 1.5 >AC024200-11|AAF36000.1| 271|Caenorhabditis elegans Hypothetical protein Y71F9AL.6 protein. Length = 271 Score = 31.1 bits (67), Expect = 0.38 Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -3 Query: 209 IIYLKNTYIYVYNFFTIY-FYILHYVKHI 126 IIY+K+T Y+Y+ + Y Y +H + HI Sbjct: 15 IIYIKSTIYYIYHIYIPYTIYTIHQIYHI 43 >AF039047-9|AAB94228.1| 303|Caenorhabditis elegans Hypothetical protein K11D12.8 protein. Length = 303 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 176 YNFFTIYFYILHYVKHISKTLKLLDLRK*SI 84 Y+FF ++FY+L ++ + K KLL R SI Sbjct: 232 YSFFVVFFYLLFFIFPVLKKPKLLQDRIISI 262 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,769,250 Number of Sequences: 27780 Number of extensions: 136069 Number of successful extensions: 328 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 321 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 328 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 777938954 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -