BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0410.Seq (914 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 103 2e-22 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 103 3e-22 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 4e-22 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 101 6e-22 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 101 6e-22 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 8e-22 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 101 8e-22 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 101 8e-22 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 101 8e-22 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 8e-22 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 8e-22 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 8e-22 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 8e-22 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 101 8e-22 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 8e-22 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 101 8e-22 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 8e-22 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 8e-22 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 8e-22 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 8e-22 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 101 8e-22 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 8e-22 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 8e-22 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 8e-22 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 101 8e-22 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 101 1e-21 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 101 1e-21 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 101 1e-21 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 100 2e-21 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 99 2e-21 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 99 2e-21 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 99 2e-21 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 99 2e-21 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 99 2e-21 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 99 2e-21 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 99 2e-21 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 99 2e-21 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 99 2e-21 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 99 2e-21 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 99 2e-21 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 99 2e-21 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 99 2e-21 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 99 2e-21 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 99 2e-21 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 99 2e-21 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 99 2e-21 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 99 2e-21 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 99 2e-21 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 99 2e-21 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 99 2e-21 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 99 2e-21 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 99 2e-21 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 99 2e-21 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 99 2e-21 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 99 2e-21 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 99 2e-21 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 99 2e-21 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 99 2e-21 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 99 2e-21 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 99 2e-21 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 99 2e-21 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 99 2e-21 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 99 2e-21 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 99 2e-21 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 99 2e-21 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 99 2e-21 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 99 2e-21 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 99 2e-21 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 99 2e-21 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 99 2e-21 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 99 2e-21 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 99 2e-21 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 100 3e-21 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 3e-21 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 99 6e-21 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 99 6e-21 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 99 6e-21 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 99 6e-21 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 99 6e-21 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) 99 6e-21 SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 99 6e-21 SB_27144| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_26705| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_24903| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_23614| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_22937| Best HMM Match : HD (HMM E-Value=1e-11) 99 6e-21 SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_22217| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_20437| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_20052| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_16432| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_16390| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_15700| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_15017| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_14731| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 99 6e-21 SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_10906| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_8712| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_7643| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) 99 6e-21 SB_58017| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_57755| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_56140| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) 99 6e-21 SB_54538| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_54475| Best HMM Match : Adeno_VII (HMM E-Value=9.4) 99 6e-21 SB_53901| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_53039| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_53031| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_52947| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_52591| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_52078| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_50071| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_50038| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_48979| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_48407| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_47429| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_47410| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_46311| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_44528| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_43898| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_43165| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_42650| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_42105| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_41672| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_41637| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_40439| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_37837| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_36825| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_35598| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_35445| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_34794| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_33898| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_33514| Best HMM Match : DUF503 (HMM E-Value=1.6) 99 6e-21 SB_33266| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_32886| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_29948| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_29695| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_27907| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_27247| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_26184| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_25988| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_25331| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_24868| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_22584| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_21335| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_21002| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_20750| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_19365| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 99 6e-21 SB_18964| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_18148| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 99 6e-21 SB_17776| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_16561| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 99 6e-21 SB_14675| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_14548| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_14046| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_13642| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_13143| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 99 6e-21 SB_12757| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_11792| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_11340| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_10857| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_10710| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_10117| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_10054| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_9618| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_9213| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_7369| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_6429| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_5748| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_4254| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_3679| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_3216| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_1518| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 6e-21 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 98 8e-21 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 8e-21 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 98 1e-20 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 98 1e-20 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 98 1e-20 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 98 1e-20 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 98 1e-20 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 98 1e-20 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 98 1e-20 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 98 1e-20 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 98 1e-20 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 98 1e-20 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 98 1e-20 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 98 1e-20 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 98 1e-20 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 98 1e-20 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 98 1e-20 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 98 1e-20 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 98 1e-20 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 98 1e-20 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 98 1e-20 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 103 bits (247), Expect = 2e-22 Identities = 48/56 (85%), Positives = 49/56 (87%) Frame = +2 Query: 461 SRITIHWPSFYNVVTGKPWALPNLIALQHIPLSPAGVIAKRPAPIRLPNSCAALNG 628 SRITIHWPSFYNVVTGK ALPNLIALQHIPLSPAGVIAKRPAPI LP +LNG Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNG 57 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 103 bits (246), Expect = 3e-22 Identities = 51/61 (83%), Positives = 53/61 (86%), Gaps = 2/61 (3%) Frame = -1 Query: 647 LTICPFAHS--RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASE 474 +TI +HS RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASE Sbjct: 254 ITIQGASHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 313 Query: 473 L 471 L Sbjct: 314 L 314 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 102 bits (245), Expect = 4e-22 Identities = 49/57 (85%), Positives = 50/57 (87%) Frame = -1 Query: 641 ICPFAHSRLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 + P A S LRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 75 LMPEAVSGLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 101 bits (243), Expect = 6e-22 Identities = 48/56 (85%), Positives = 48/56 (85%) Frame = -1 Query: 638 CPFAHSRLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 C RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 261 CEDRCERLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 101 bits (243), Expect = 6e-22 Identities = 47/55 (85%), Positives = 48/55 (87%) Frame = -1 Query: 635 PFAHSRLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 P +LRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 246 PVNREKLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 101 bits (242), Expect = 8e-22 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 8 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 101 bits (242), Expect = 8e-22 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 220 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 101 bits (242), Expect = 8e-22 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 375 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 101 bits (242), Expect = 8e-22 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 291 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 101 bits (242), Expect = 8e-22 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 8 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 101 bits (242), Expect = 8e-22 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 8 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 101 bits (242), Expect = 8e-22 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 8 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 101 bits (242), Expect = 8e-22 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 31 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 101 bits (242), Expect = 8e-22 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 240 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 101 bits (242), Expect = 8e-22 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 449 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 101 bits (242), Expect = 8e-22 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 284 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 101 bits (242), Expect = 8e-22 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 134 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 101 bits (242), Expect = 8e-22 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 8 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 101 bits (242), Expect = 8e-22 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 8 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 101 bits (242), Expect = 8e-22 Identities = 49/56 (87%), Positives = 51/56 (91%), Gaps = 1/56 (1%) Frame = -1 Query: 635 PFAHS-RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 P A+S +LRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 187 PSANSNKLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 101 bits (242), Expect = 8e-22 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 585 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 101 bits (242), Expect = 8e-22 Identities = 52/72 (72%), Positives = 54/72 (75%) Frame = -1 Query: 686 NKNLTRILTKYLTLTICPFAHSRLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVS 507 NKN R + C A +LRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP S Sbjct: 201 NKNSKRFQGNSQSSKYCISA--KLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFS 258 Query: 506 QSRRCKTTASEL 471 QSRRCKTTASEL Sbjct: 259 QSRRCKTTASEL 270 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 101 bits (242), Expect = 8e-22 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 499 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 101 bits (242), Expect = 8e-22 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 390 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 101 bits (242), Expect = 8e-22 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 183 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 101 bits (241), Expect = 1e-21 Identities = 47/52 (90%), Positives = 48/52 (92%) Frame = -1 Query: 626 HSRLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 +S LRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 355 YSGLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 101 bits (241), Expect = 1e-21 Identities = 52/81 (64%), Positives = 59/81 (72%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 652 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 708 Query: 658 FVKIRVKFLLNQLIFNPLGRN 720 F+ + + L+ G N Sbjct: 709 FLLTHLSRSSDDLLDIDFGHN 729 >SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) Length = 630 Score = 101 bits (241), Expect = 1e-21 Identities = 51/81 (62%), Positives = 60/81 (74%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 437 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 493 Query: 658 FVKIRVKFLLNQLIFNPLGRN 720 F+ + L+ ++ + N Sbjct: 494 FLLTHLCVLMTAVMIPLIASN 514 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 100 bits (240), Expect = 1e-21 Identities = 48/55 (87%), Positives = 48/55 (87%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL*YDSL 456 RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASE D L Sbjct: 8 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 97.9 bits (233), Expect = 1e-20 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 136 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 100 bits (239), Expect = 2e-21 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 +LRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 224 KLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 118 Query: 658 FV 663 F+ Sbjct: 119 FL 120 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 81 Query: 658 FV 663 F+ Sbjct: 82 FL 83 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 105 Query: 658 FV 663 F+ Sbjct: 106 FL 107 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 84 Query: 658 FV 663 F+ Sbjct: 85 FL 86 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 833 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 889 Query: 658 FV 663 F+ Sbjct: 890 FL 891 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 170 Query: 658 FV 663 F+ Sbjct: 171 FL 172 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 95 Query: 658 FV 663 F+ Sbjct: 96 FL 97 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 67 Query: 658 FV 663 F+ Sbjct: 68 FL 69 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 144 Query: 658 FV 663 F+ Sbjct: 145 FL 146 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 78 Query: 658 FV 663 F+ Sbjct: 79 FL 80 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 209 Query: 658 FV 663 F+ Sbjct: 210 FL 211 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 113 Query: 658 FV 663 F+ Sbjct: 114 FL 115 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 116 Query: 658 FV 663 F+ Sbjct: 117 FL 118 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 99 bits (238), Expect = 2e-21 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 +LRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 888 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 269 Query: 658 FV 663 F+ Sbjct: 270 FL 271 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 104 Query: 658 FV 663 F+ Sbjct: 105 FL 106 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 96 Query: 658 FV 663 F+ Sbjct: 97 FL 98 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 131 Query: 658 FV 663 F+ Sbjct: 132 FL 133 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 78 Query: 658 FV 663 F+ Sbjct: 79 FL 80 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 113 Query: 658 FV 663 F+ Sbjct: 114 FL 115 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 129 Query: 658 FV 663 F+ Sbjct: 130 FL 131 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 84 Query: 658 FV 663 F+ Sbjct: 85 FL 86 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 115 Query: 658 FV 663 F+ Sbjct: 116 FL 117 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 144 Query: 658 FV 663 F+ Sbjct: 145 FL 146 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 156 Query: 658 FV 663 F+ Sbjct: 157 FL 158 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 88 Query: 658 FV 663 F+ Sbjct: 89 FL 90 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 181 Query: 658 FV 663 F+ Sbjct: 182 FL 183 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 96 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 152 Query: 658 FV 663 F+ Sbjct: 153 FL 154 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 117 Query: 658 FV 663 F+ Sbjct: 118 FL 119 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 140 Query: 658 FV 663 F+ Sbjct: 141 FL 142 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 140 Query: 658 FV 663 F+ Sbjct: 141 FL 142 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 140 Query: 658 FV 663 F+ Sbjct: 141 FL 142 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 121 Query: 658 FV 663 F+ Sbjct: 122 FL 123 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 80 Query: 658 FV 663 F+ Sbjct: 81 FL 82 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 164 Query: 658 FV 663 F+ Sbjct: 165 FL 166 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 80 Query: 658 FV 663 F+ Sbjct: 81 FL 82 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 99 Query: 658 FV 663 F+ Sbjct: 100 FL 101 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 132 Query: 658 FV 663 F+ Sbjct: 133 FL 134 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 123 Query: 658 FV 663 F+ Sbjct: 124 FL 125 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 91 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 147 Query: 658 FV 663 F+ Sbjct: 148 FL 149 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 97 Query: 658 FV 663 F+ Sbjct: 98 FL 99 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 190 Query: 658 FV 663 F+ Sbjct: 191 FL 192 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 182 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 238 Query: 658 FV 663 F+ Sbjct: 239 FL 240 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 115 Query: 658 FV 663 F+ Sbjct: 116 FL 117 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 202 Query: 658 FV 663 F+ Sbjct: 203 FL 204 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 114 Query: 658 FV 663 F+ Sbjct: 115 FL 116 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 116 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 172 Query: 658 FV 663 F+ Sbjct: 173 FL 174 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 23 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 79 Query: 658 FV 663 F+ Sbjct: 80 FL 81 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 95 Query: 658 FV 663 F+ Sbjct: 96 FL 97 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 217 Query: 658 FV 663 F+ Sbjct: 218 FL 219 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 78 Query: 658 FV 663 F+ Sbjct: 79 FL 80 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 126 Query: 658 FV 663 F+ Sbjct: 127 FL 128 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 127 Query: 658 FV 663 F+ Sbjct: 128 FL 129 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 135 Query: 658 FV 663 F+ Sbjct: 136 FL 137 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 241 Query: 658 FV 663 F+ Sbjct: 242 FL 243 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 444 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 500 Query: 658 FV 663 F+ Sbjct: 501 FL 502 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 129 Query: 658 FV 663 F+ Sbjct: 130 FL 131 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 266 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 322 Query: 658 FV 663 F+ Sbjct: 323 FL 324 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 90 Query: 658 FV 663 F+ Sbjct: 91 FL 92 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 126 Query: 658 FV 663 F+ Sbjct: 127 FL 128 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 160 Query: 658 FV 663 F+ Sbjct: 161 FL 162 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 119 Query: 658 FV 663 F+ Sbjct: 120 FL 121 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 129 Query: 658 FV 663 F+ Sbjct: 130 FL 131 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 129 Query: 658 FV 663 F+ Sbjct: 130 FL 131 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 74 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 130 Query: 658 FV 663 F+ Sbjct: 131 FL 132 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 139 Query: 658 FV 663 F+ Sbjct: 140 FL 141 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 176 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 232 Query: 658 FV 663 F+ Sbjct: 233 FL 234 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 87 Query: 658 FV 663 F+ Sbjct: 88 FL 89 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 139 Query: 658 FV 663 F+ Sbjct: 140 FL 141 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 105 Query: 658 FV 663 F+ Sbjct: 106 FL 107 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 124 Query: 658 FV 663 F+ Sbjct: 125 FL 126 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 113 Query: 658 FV 663 F+ Sbjct: 114 FL 115 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 125 Query: 658 FV 663 F+ Sbjct: 126 FL 127 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 94 Query: 658 FV 663 F+ Sbjct: 95 FL 96 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 100 Query: 658 FV 663 F+ Sbjct: 101 FL 102 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 118 Query: 658 FV 663 F+ Sbjct: 119 FL 120 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 137 Query: 658 FV 663 F+ Sbjct: 138 FL 139 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 87 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 143 Query: 658 FV 663 F+ Sbjct: 144 FL 145 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 160 Query: 658 FV 663 F+ Sbjct: 161 FL 162 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 94 Query: 658 FV 663 F+ Sbjct: 95 FL 96 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 106 Query: 658 FV 663 F+ Sbjct: 107 FL 108 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 105 Query: 658 FV 663 F+ Sbjct: 106 FL 107 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 182 Query: 658 FV 663 F+ Sbjct: 183 FL 184 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 125 Query: 658 FV 663 F+ Sbjct: 126 FL 127 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 111 Query: 658 FV 663 F+ Sbjct: 112 FL 113 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 110 Query: 658 FV 663 F+ Sbjct: 111 FL 112 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 144 Query: 658 FV 663 F+ Sbjct: 145 FL 146 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 111 Query: 658 FV 663 F+ Sbjct: 112 FL 113 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 94 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 150 Query: 658 FV 663 F+ Sbjct: 151 FL 152 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 121 Query: 658 FV 663 F+ Sbjct: 122 FL 123 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 167 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 223 Query: 658 FV 663 F+ Sbjct: 224 FL 225 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 135 Query: 658 FV 663 F+ Sbjct: 136 FL 137 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 113 Query: 658 FV 663 F+ Sbjct: 114 FL 115 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 105 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 161 Query: 658 FV 663 F+ Sbjct: 162 FL 163 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 92 Query: 658 FV 663 F+ Sbjct: 93 FL 94 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 175 Query: 658 FV 663 F+ Sbjct: 176 FL 177 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 152 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 208 Query: 658 FV 663 F+ Sbjct: 209 FL 210 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 102 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 158 Query: 658 FV 663 F+ Sbjct: 159 FL 160 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 90 Query: 658 FV 663 F+ Sbjct: 91 FL 92 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 93 Query: 658 FV 663 F+ Sbjct: 94 FL 95 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 99 bits (238), Expect = 2e-21 Identities = 46/49 (93%), Positives = 46/49 (93%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASE 474 RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASE Sbjct: 530 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 578 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 125 Query: 658 FV 663 F+ Sbjct: 126 FL 127 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 182 Query: 658 FV 663 F+ Sbjct: 183 FL 184 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 82 Query: 658 FV 663 F+ Sbjct: 83 FL 84 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 127 Query: 658 FV 663 F+ Sbjct: 128 FL 129 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 141 Query: 658 FV 663 F+ Sbjct: 142 FL 143 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 149 Query: 658 FV 663 F+ Sbjct: 150 FL 151 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 72 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 128 Query: 658 FV 663 F+ Sbjct: 129 FL 130 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 149 Query: 658 FV 663 F+ Sbjct: 150 FL 151 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 163 Query: 658 FV 663 F+ Sbjct: 164 FL 165 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 137 Query: 658 FV 663 F+ Sbjct: 138 FL 139 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 164 Query: 658 FV 663 F+ Sbjct: 165 FL 166 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 306 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 362 Query: 658 FV 663 F+ Sbjct: 363 FL 364 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 108 Query: 658 FV 663 F+ Sbjct: 109 FL 110 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 15 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 71 Query: 658 FV 663 F+ Sbjct: 72 FL 73 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 82 Query: 658 FV 663 F+ Sbjct: 83 FL 84 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 112 Query: 658 FV 663 F+ Sbjct: 113 FL 114 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 247 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 303 Query: 658 FV 663 F+ Sbjct: 304 FL 305 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 137 Query: 658 FV 663 F+ Sbjct: 138 FL 139 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 90 Query: 658 FV 663 F+ Sbjct: 91 FL 92 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 104 Query: 658 FV 663 F+ Sbjct: 105 FL 106 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 80 Query: 658 FV 663 F+ Sbjct: 81 FL 82 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 204 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 260 Query: 658 FV 663 F+ Sbjct: 261 FL 262 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 119 Query: 658 FV 663 F+ Sbjct: 120 FL 121 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 719 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 775 Query: 658 FV 663 F+ Sbjct: 776 FL 777 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 95 Query: 658 FV 663 F+ Sbjct: 96 FL 97 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 187 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 243 Query: 658 FV 663 F+ Sbjct: 244 FL 245 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 115 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 171 Query: 658 FV 663 F+ Sbjct: 172 FL 173 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 30 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 86 Query: 658 FV 663 F+ Sbjct: 87 FL 88 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 76 Query: 658 FV 663 F+ Sbjct: 77 FL 78 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 141 Query: 658 FV 663 F+ Sbjct: 142 FL 143 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 88 Query: 658 FV 663 F+ Sbjct: 89 FL 90 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 109 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 165 Query: 658 FV 663 F+ Sbjct: 166 FL 167 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 77 Query: 658 FV 663 F+ Sbjct: 78 FL 79 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 93 Query: 658 FV 663 F+ Sbjct: 94 FL 95 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 116 Query: 658 FV 663 F+ Sbjct: 117 FL 118 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 77 Query: 658 FV 663 F+ Sbjct: 78 FL 79 >SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 97 Query: 658 FV 663 F+ Sbjct: 98 FL 99 >SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 123 Query: 658 FV 663 F+ Sbjct: 124 FL 125 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 100 Query: 658 FV 663 F+ Sbjct: 101 FL 102 >SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 118 Query: 658 FV 663 F+ Sbjct: 119 FL 120 >SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) Length = 191 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 121 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 177 Query: 658 FV 663 F+ Sbjct: 178 FL 179 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 125 Query: 658 FV 663 F+ Sbjct: 126 FL 127 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 364 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 420 Query: 658 FV 663 F+ Sbjct: 421 FL 422 >SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) Length = 267 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 97 Query: 658 FV 663 F+ Sbjct: 98 FL 99 >SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) Length = 144 Score = 99 bits (238), Expect = 2e-21 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSLEWANGQIVSVKY 657 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL NG+ ++Y Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL---NGEWRLMRY 110 Query: 658 FV 663 F+ Sbjct: 111 FL 112 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 99.5 bits (237), Expect = 3e-21 Identities = 46/49 (93%), Positives = 46/49 (93%) Frame = -1 Query: 617 LRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 LRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 99.5 bits (237), Expect = 3e-21 Identities = 46/49 (93%), Positives = 46/49 (93%) Frame = -1 Query: 617 LRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 LRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 99.5 bits (237), Expect = 3e-21 Identities = 46/49 (93%), Positives = 46/49 (93%) Frame = -1 Query: 617 LRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 LRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 99.5 bits (237), Expect = 3e-21 Identities = 46/49 (93%), Positives = 46/49 (93%) Frame = -1 Query: 623 SRLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTAS 477 SRLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTAS Sbjct: 109 SRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 157 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 99.5 bits (237), Expect = 3e-21 Identities = 46/49 (93%), Positives = 46/49 (93%) Frame = -1 Query: 617 LRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 LRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 99.5 bits (237), Expect = 3e-21 Identities = 46/49 (93%), Positives = 46/49 (93%) Frame = -1 Query: 617 LRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTASEL 471 LRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTASEL Sbjct: 119 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 99.5 bits (237), Expect = 3e-21 Identities = 45/48 (93%), Positives = 45/48 (93%) Frame = +2 Query: 476 HWPSFYNVVTGKPWALPNLIALQHIPLSPAGVIAKRPAPIRLPNSCAA 619 HWPSFYNVVTGK ALPNLIALQHIPLSPAGVIAKRPAPI LPNSCAA Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCAA 109 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 99.5 bits (237), Expect = 3e-21 Identities = 45/48 (93%), Positives = 45/48 (93%) Frame = +2 Query: 476 HWPSFYNVVTGKPWALPNLIALQHIPLSPAGVIAKRPAPIRLPNSCAA 619 HWPSFYNVVTGK ALPNLIALQHIPLSPAGVIAKRPAPI LPNSCAA Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCAA 104 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 42 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 93 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 35 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 86 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 54 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 105 >SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) Length = 181 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 90 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 141 >SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 42 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 93 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 51 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 102 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 52 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 103 >SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) Length = 241 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 151 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 202 >SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 28 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 79 >SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 8 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 57 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 108 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 46 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 97 >SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) Length = 499 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 408 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 459 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 95 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 146 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 37 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 88 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 35 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 86 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 515 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 566 Score = 96.3 bits (229), Expect = 3e-20 Identities = 44/47 (93%), Positives = 44/47 (93%) Frame = -1 Query: 620 RLRNCWEGESVRASSLLRQLAKGGCAARRLSWVTPRVSQSRRCKTTA 480 RLRNCWEG SVRASSLLRQLAKGGCAARRLSWVTP SQSRRCKTTA Sbjct: 183 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 229 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 67 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 118 >SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 8 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 36 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 56 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 107 >SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) Length = 148 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 57 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 108 >SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 56 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 107 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 49 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 100 >SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 36 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 55 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 106 >SB_27144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 84 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 135 >SB_26705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 66 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 117 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 71 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 122 >SB_24903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_23614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1601 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 1365 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 1416 >SB_22937| Best HMM Match : HD (HMM E-Value=1e-11) Length = 248 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 158 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 209 >SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_22217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_20437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_20052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 41 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 92 >SB_16432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 59 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 110 >SB_16390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_15700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_15017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 37 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 88 >SB_14731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 8 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) Length = 280 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 189 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 240 >SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 87 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 138 >SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 63 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 114 >SB_10906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_8712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 38 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 89 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 95 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 146 >SB_7643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 71 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 122 >SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 48 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 99 >SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 37 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 88 >SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) Length = 181 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 90 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 141 >SB_58017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 98.7 bits (235), Expect = 6e-21 Identities = 47/52 (90%), Positives = 47/52 (90%), Gaps = 2/52 (3%) Frame = +1 Query: 478 LAVVLQRRDWETLGVTQLNRLAAHPPFASWRNSEEARTDSPSQQLRSL--EW 627 LAVVLQRRDWE GVTQLNRLAAHPPFASWRNSEEARTD PSQQLRSL EW Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,448,644 Number of Sequences: 59808 Number of extensions: 477325 Number of successful extensions: 5292 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5277 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2645618622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -