BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0409.Seq (625 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39648-6|AAM15602.1| 557|Caenorhabditis elegans Abnormal dauer ... 27 8.2 U39648-5|AAK39293.1| 572|Caenorhabditis elegans Abnormal dauer ... 27 8.2 AF407572-1|AAL65132.1| 557|Caenorhabditis elegans DAF-9 isoform... 27 8.2 >U39648-6|AAM15602.1| 557|Caenorhabditis elegans Abnormal dauer formation protein9, isoform b protein. Length = 557 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +1 Query: 40 FVNKLADDNAYLEFNVVYGATFFEH*LRSARVATERSCFNKILMVN 177 FVN L + +LE+ +YG F H + + E + L+ N Sbjct: 107 FVNILTPEQTFLEYREIYGPIFTLHLSQPTIILAEYKTIQEALVKN 152 >U39648-5|AAK39293.1| 572|Caenorhabditis elegans Abnormal dauer formation protein9, isoform a protein. Length = 572 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +1 Query: 40 FVNKLADDNAYLEFNVVYGATFFEH*LRSARVATERSCFNKILMVN 177 FVN L + +LE+ +YG F H + + E + L+ N Sbjct: 122 FVNILTPEQTFLEYREIYGPIFTLHLSQPTIILAEYKTIQEALVKN 167 >AF407572-1|AAL65132.1| 557|Caenorhabditis elegans DAF-9 isoform A protein. Length = 557 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +1 Query: 40 FVNKLADDNAYLEFNVVYGATFFEH*LRSARVATERSCFNKILMVN 177 FVN L + +LE+ +YG F H + + E + L+ N Sbjct: 107 FVNILTPEQTFLEYREIYGPIFTLHLSQPTIILAEYKTIQEALVKN 152 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,924,692 Number of Sequences: 27780 Number of extensions: 193510 Number of successful extensions: 318 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 315 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 318 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1363963182 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -