BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0408.Seq (702 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1711.12 |||serine peptidase |Schizosaccharomyces pombe|chr 2... 26 4.5 SPAC12G12.12 |||NST UDP-galactose transporter|Schizosaccharomyce... 25 7.9 >SPBC1711.12 |||serine peptidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 683 Score = 26.2 bits (55), Expect = 4.5 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 4/36 (11%) Frame = -3 Query: 307 ATKDYRLS*SDRLHLINIMKTQSHSSRLL----ENH 212 ++KDYRL+ S+ + N+++ + SRLL ENH Sbjct: 614 SSKDYRLTESEGIAAFNVLQYKGIPSRLLVFEDENH 649 >SPAC12G12.12 |||NST UDP-galactose transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 324 Score = 25.4 bits (53), Expect = 7.9 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 6/50 (12%) Frame = -2 Query: 434 YTLAQTQASGLEVDEVPIELDLIKGT------IYGFVVNYYFVISLGIGY 303 +T+ + S ++VD P EL +GT + G +++YYF+ S GY Sbjct: 176 FTIEEYILSFIQVD--PSELVAYEGTYGVFFVLLGMIISYYFIGSTTAGY 223 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,321,418 Number of Sequences: 5004 Number of extensions: 38979 Number of successful extensions: 83 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 325165428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -