BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0408.Seq (702 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0064 + 542101-542291,542391-542453,542559-542675,542763-54... 31 0.89 >06_01_0064 + 542101-542291,542391-542453,542559-542675,542763-542892, 543010-543168,543839-543990,544313-544436,544629-544669, 545512-545757,546010-546126,546683-547097,548698-548849, 548960-549104 Length = 683 Score = 31.1 bits (67), Expect = 0.89 Identities = 23/89 (25%), Positives = 39/89 (43%) Frame = -2 Query: 452 SGFNYYYTLAQTQASGLEVDEVPIELDLIKGTIYGFVVNYYFVISLGIGYQRLSFKLIRQ 273 + F ++ Q A L + I + +KG I V Y V++ G GY L++ + ++ Sbjct: 545 TAFMSLFSCLQAGALALSIQRSSISIWALKGKIEIATVVYCGVVASGFGYLMLTYCVEKR 604 Query: 272 TPSDKYNENAESQLTIAGESLI*CRENNY 186 P + SQ+ +AG L E Y Sbjct: 605 GPVFTAAFSPLSQIFVAGIDLFILHEPLY 633 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,687,694 Number of Sequences: 37544 Number of extensions: 212289 Number of successful extensions: 352 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 352 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1803843684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -