BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0408.Seq (702 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF022978-3|AAG24182.2| 403|Caenorhabditis elegans Hypothetical ... 28 7.4 Z81556-7|CAB04519.1| 569|Caenorhabditis elegans Hypothetical pr... 27 9.8 >AF022978-3|AAG24182.2| 403|Caenorhabditis elegans Hypothetical protein T01G6.6 protein. Length = 403 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 161 WLCYLKSFYNYSRGIR*VILQQS*AVTLRFHYIYQ 265 WL +L FY+ RG++ IL + + R H + Q Sbjct: 202 WLSFLDGFYSLPRGVQMQILMSTWHLRARLHRLSQ 236 >Z81556-7|CAB04519.1| 569|Caenorhabditis elegans Hypothetical protein F58G1.7 protein. Length = 569 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -2 Query: 449 GFNYYYTLAQTQASGLEVDEVPIEL-DLIKGTIYGFVVNYYFVIS 318 G YY + Q+ G+ V L D++ + GF VN+Y + S Sbjct: 201 GIFLYYAVQDVQSFGILVPVENFRLSDILSSLMVGFTVNFYLLNS 245 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,503,356 Number of Sequences: 27780 Number of extensions: 207365 Number of successful extensions: 414 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 414 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1624019012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -