BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0408.Seq (702 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g05700.1 68414.m00591 leucine-rich repeat protein kinase, put... 28 6.9 At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-rel... 27 9.1 >At1g05700.1 68414.m00591 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase, gi|2129635; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 843 Score = 27.9 bits (59), Expect = 6.9 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = -2 Query: 542 VRDVNFLEESNSHTCTFPDAEQLINSRSRKSGFNYYYTLAQTQASG 405 V D +F+E S + F QL N RS G YTL Q G Sbjct: 54 VSDSSFVETGVSKSIPFTAQRQLQNLRSFPEGSRNCYTLIPIQGKG 99 >At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-related contains Pfam PF02138: Beige/BEACH domain; contains Pfam PF00400: WD domain, G-beta repeat (3 copies) Length = 2946 Score = 27.5 bits (58), Expect = 9.1 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 59 RKGPLHLVHCFLPVCW 12 RK LH H F P CW Sbjct: 478 RKSSLHFTHAFKPQCW 493 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,586,077 Number of Sequences: 28952 Number of extensions: 186718 Number of successful extensions: 304 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 302 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 304 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -