BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0407.Seq (934 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 23 5.2 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 22 9.2 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 22.6 bits (46), Expect = 5.2 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 432 RDLHTLYVTSRSMTYLMLSPHYRSTYFLFVSSLLPMFNDC 551 RD T S +L L P STY F DC Sbjct: 356 RDFQTTPTVSVEQPHLFLYPEVSSTYTGFGIQSTDFVGDC 395 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.8 bits (44), Expect = 9.2 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = -3 Query: 617 VQWRYSFDISEI*RGN 570 ++++YS++IS RGN Sbjct: 265 IEFKYSYEISNAFRGN 280 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 241,265 Number of Sequences: 438 Number of extensions: 5551 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 30476628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -