BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0406.Seq (525 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19B12.05c |fcp1||CTD phosphatase Fcp1 |Schizosaccharomyces p... 27 1.3 SPAPB1E7.06c |eme1||Holliday junction resolvase subunit Eme1|Sch... 25 5.2 >SPAC19B12.05c |fcp1||CTD phosphatase Fcp1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 723 Score = 27.5 bits (58), Expect = 1.3 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +2 Query: 17 DMLGPEQGYEGLYGTRPSFHQQGYDQIPIDSMQGLE 124 D++ P Y+G + + + +GYD +P S +G E Sbjct: 664 DLIQPSYNYDGEKRRKENDNHEGYDLLPNSSTKGEE 699 >SPAPB1E7.06c |eme1||Holliday junction resolvase subunit Eme1|Schizosaccharomyces pombe|chr 1|||Manual Length = 738 Score = 25.4 bits (53), Expect = 5.2 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +1 Query: 232 AAWYDTDLKQIERFKCNFIV 291 ++WY T Q++ + C F+V Sbjct: 453 SSWYSTVRSQLDSYNCQFVV 472 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,799,012 Number of Sequences: 5004 Number of extensions: 31009 Number of successful extensions: 68 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 214353836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -