BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0406.Seq (525 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_1093 + 8627731-8627889,8627934-8627996,8628671-8628721 33 0.14 01_07_0082 - 40965947-40967023 28 4.0 >01_01_1093 + 8627731-8627889,8627934-8627996,8628671-8628721 Length = 90 Score = 33.1 bits (72), Expect = 0.14 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -3 Query: 106 IYRYLIVALLVKGWSGPIQALVTLLWPEHVLYIG 5 +Y Y LLV WSG IQ L +W +H++ IG Sbjct: 34 LYNYWKSLLLVLVWSGMIQDLQAGMWIDHIVMIG 67 >01_07_0082 - 40965947-40967023 Length = 358 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = +2 Query: 29 PEQGYEGLYGTRPSFHQQGYDQIPIDSMQGLEIGSGFGMDMDIGXAEG 172 P+ GY G YG P GY Q + + G G G + +G A G Sbjct: 282 PQAGYGGGYGYPPQAGYGGYQQQAVKPAKKNNFGMGLGAGL-LGGALG 328 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,454,551 Number of Sequences: 37544 Number of extensions: 198548 Number of successful extensions: 472 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 472 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1154538620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -