BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0406.Seq (525 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g21060.1 68416.m02662 transducin family protein / WD-40 repea... 27 5.8 >At3g21060.1 68416.m02662 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to Retinoblastoma-binding protein 5 (RBBP-5) [Homo sapiens](RBQ-3) Length = 547 Score = 27.5 bits (58), Expect = 5.8 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -3 Query: 112 HRIYRYLIVALLVKGWSGPIQALVTLLW-PEHVLYIGL 2 H+IY + LVK GP +AL+ L W P H + + + Sbjct: 317 HKIYIWDRAGHLVKILEGPKEALIDLAWHPVHPIIVSV 354 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,344,068 Number of Sequences: 28952 Number of extensions: 161647 Number of successful extensions: 385 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 376 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 385 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 967280384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -