SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ps4M0406.Seq
         (525 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g21060.1 68416.m02662 transducin family protein / WD-40 repea...    27   5.8  

>At3g21060.1 68416.m02662 transducin family protein / WD-40 repeat
           family protein contains 4 WD-40 repeats (PF00400);
           similar to Retinoblastoma-binding protein 5 (RBBP-5)
           [Homo sapiens](RBQ-3)
          Length = 547

 Score = 27.5 bits (58), Expect = 5.8
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = -3

Query: 112 HRIYRYLIVALLVKGWSGPIQALVTLLW-PEHVLYIGL 2
           H+IY +     LVK   GP +AL+ L W P H + + +
Sbjct: 317 HKIYIWDRAGHLVKILEGPKEALIDLAWHPVHPIIVSV 354


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,344,068
Number of Sequences: 28952
Number of extensions: 161647
Number of successful extensions: 385
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 376
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 385
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 967280384
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -