BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0402.Seq (851 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) 194 8e-50 SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) 32 0.51 SB_23120| Best HMM Match : Mucin (HMM E-Value=0.033) 30 2.1 SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) 29 3.6 SB_20635| Best HMM Match : rve (HMM E-Value=0.91) 29 4.8 SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_52533| Best HMM Match : rve (HMM E-Value=2) 29 4.8 SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) 29 4.8 SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) 29 4.8 SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) 28 8.4 SB_53315| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 28 8.4 SB_24473| Best HMM Match : An_peroxidase (HMM E-Value=0) 28 8.4 >SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 194 bits (473), Expect = 8e-50 Identities = 106/177 (59%), Positives = 120/177 (67%), Gaps = 1/177 (0%) Frame = +3 Query: 219 QTREHLLVF-FTNKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNG 395 +T EH+ +F KEFEIIDFFLG +L DEVLKIMPVQKQTRAGQRTRFKAFVAIGD+NG Sbjct: 24 KTLEHIYLFSLPIKEFEIIDFFLGAALKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDSNG 83 Query: 396 HIGLGVKCSKEVATAIRGAIILAKLSVLPVRRGYWGNK*ESHTPSLARSPASVVP*QSG* 575 H+GLGVKCSKEVATAIRGAIILAKLSV+PVRRGYWGNK + + Sbjct: 84 HVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGKPHTVPCKVTGKCGSTRVRL 143 Query: 576 FXXXXXXXXXXRQFPKKLLQMAGVQDCYTSASWFNWHLWKFC*SHITLAIAKTYAYL 746 PKKLLQMAG++DCYTS L F + AI++TYAYL Sbjct: 144 IPAPRGTGIVSAPVPKKLLQMAGIEDCYTSTRGQTATLGNFAKATFA-AISETYAYL 199 Score = 78.6 bits (185), Expect = 6e-15 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +2 Query: 500 G*QIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSAPV 616 G +IGKPHTVPCKVTGKCGS VRLIPAPRGTGIVSAPV Sbjct: 119 GNKIGKPHTVPCKVTGKCGSTRVRLIPAPRGTGIVSAPV 157 Score = 52.0 bits (119), Expect = 6e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +1 Query: 169 WVPVTKLGRLVREGKIDKLESIYLFSLPIK 258 WVPVTKLGRLV++ KI LE IYLFSLPIK Sbjct: 8 WVPVTKLGRLVKDLKIKTLEHIYLFSLPIK 37 >SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1049 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = -1 Query: 470 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDLKNLIIQG 291 ++ + NS N D TNMT + + G CL + TC+ L DL NL+ + Sbjct: 235 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 292 Query: 290 RAEEEI 273 R ++E+ Sbjct: 293 RNQDEL 298 >SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) Length = 657 Score = 32.3 bits (70), Expect = 0.51 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = -1 Query: 470 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDLKNLIIQG 291 ++ + NS N D TNMT + + G CL + TC+ L DL NL+ + Sbjct: 519 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 576 Query: 290 RAEEEI 273 R ++E+ Sbjct: 577 RNQDEL 582 >SB_23120| Best HMM Match : Mucin (HMM E-Value=0.033) Length = 382 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = -2 Query: 193 GRVW*QEPTLSGLPCRAHDHGRDHDRVHEDRHGLYLH 83 G +W + L LP H DHDR H RH +H Sbjct: 103 GFLWQKNGVLLSLPPPQFRHSHDHDRHHYHRHHNNIH 139 >SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) Length = 280 Score = 29.5 bits (63), Expect = 3.6 Identities = 19/44 (43%), Positives = 23/44 (52%) Frame = -1 Query: 443 NGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL 312 N G LA + N+ +V NG K + C LS T L LY HDL Sbjct: 108 NAYGKSLAEFYNSNNL--IVLNGVK--QGCMLSPTLLNLYVHDL 147 >SB_20635| Best HMM Match : rve (HMM E-Value=0.91) Length = 748 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 297 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 410 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 155 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 192 >SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 297 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 410 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 811 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 848 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 297 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 410 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 2008 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 2045 >SB_52533| Best HMM Match : rve (HMM E-Value=2) Length = 212 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 297 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 410 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 95 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 132 >SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) Length = 212 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 297 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 410 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 9 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 46 >SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) Length = 735 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 297 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 410 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 532 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 569 >SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) Length = 1130 Score = 28.3 bits (60), Expect = 8.4 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 347 TAHTFQGICCHWRQQRSYW 403 TA + ICCH +Q + +W Sbjct: 486 TADQYDAICCHTQQSKKFW 504 >SB_53315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 303 Score = 28.3 bits (60), Expect = 8.4 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -2 Query: 649 CTPAI*RSFLGNWRRHNTSTTRGRNQPDC-YGTTLAGDLARDG 524 CTPAI R G++ + T G N P+C + L D A G Sbjct: 221 CTPAIVRDTCGDYLARFSRDTCGINVPECLFTAVLVKDAAGGG 263 >SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 897 Score = 28.3 bits (60), Expect = 8.4 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +3 Query: 345 GQRTRFKAFVAIGDNNGHIGLGVKCSKEVA 434 G++ + K F+A+G NGH+ C ++A Sbjct: 356 GRKDKRKDFLALGLRNGHVEFRFSCGADIA 385 >SB_24473| Best HMM Match : An_peroxidase (HMM E-Value=0) Length = 647 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 Query: 629 SSDGWCTGLLHVSFVVQLAPLEILLKPHY 715 S+DG C L H + L PL+ LL+P Y Sbjct: 148 SADGTCNNLQHPMWGGSLTPLKRLLRPIY 176 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,793,944 Number of Sequences: 59808 Number of extensions: 565946 Number of successful extensions: 1677 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1489 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1675 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2419355818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -