BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0402.Seq (851 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 26 0.38 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 24 1.5 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 24 1.5 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 24 1.5 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 24 1.5 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 3.6 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 23 4.7 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 6.2 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 6.2 DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. 22 8.2 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 8.2 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 8.2 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 26.2 bits (55), Expect = 0.38 Identities = 16/59 (27%), Positives = 25/59 (42%) Frame = +3 Query: 183 QTRPSCSRRKNRQTREHLLVFFTNKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTR 359 +T PS + R+ EH L F N ++ + +FL N ++K T Q R Sbjct: 192 ETFPSVYSKTRRRALEHTLDRFHNDKYSNVPYFLFGDFNFRTDTAGVIKKLTEDTQERR 250 Score = 22.2 bits (45), Expect = 6.2 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = -3 Query: 243 KQVNALEFVDFSFANKTAEFGDRNPLFLVF 154 + +++ + V++ T GD P+FL F Sbjct: 355 QDISSPDAVEYGIIGPTTCMGDHKPVFLEF 384 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 24.2 bits (50), Expect = 1.5 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 Query: 210 KNRQTREHLLVFFT 251 KN QTREH L+ FT Sbjct: 129 KNGQTREHALLAFT 142 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 24.2 bits (50), Expect = 1.5 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 Query: 210 KNRQTREHLLVFFT 251 KN QTREH L+ FT Sbjct: 56 KNGQTREHALLAFT 69 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 24.2 bits (50), Expect = 1.5 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 Query: 210 KNRQTREHLLVFFT 251 KN QTREH L+ FT Sbjct: 72 KNGQTREHALLAFT 85 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 24.2 bits (50), Expect = 1.5 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 Query: 210 KNRQTREHLLVFFT 251 KN QTREH L+ FT Sbjct: 129 KNGQTREHALLAFT 142 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 23.0 bits (47), Expect = 3.6 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = -1 Query: 635 LKKLLRKLAQTQYQYHEGQESAGLLRNHTCR*PCK 531 L KL ++ T + E E G +R+H CK Sbjct: 102 LPKLFKEWGTTNLTFEEDPEPFGRVRDHNISALCK 136 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.6 bits (46), Expect = 4.7 Identities = 16/66 (24%), Positives = 27/66 (40%) Frame = -2 Query: 610 RRHNTSTTRGRNQPDCYGTTLAGDLARDGVWLSYLLPQ*PLRTGRTDSLARIIAPRMAVA 431 R TS R + TL G R+G+ LS P T++L + M++ Sbjct: 533 RSGQTSVQRASTEFGIPTGTLYGRCKREGIELSRSNPTPWSEDAMTEALEAVRLGHMSIN 592 Query: 430 TSLLHF 413 + +H+ Sbjct: 593 QAAIHY 598 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.2 bits (45), Expect = 6.2 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 Query: 391 TVILVWV*SAARKSPL 438 T++LVW SAA SP+ Sbjct: 306 TILLVWAISAAIGSPI 321 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 22.2 bits (45), Expect = 6.2 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 162 ERVGSCHQTRPSCSRRKNRQTRE 230 + S + SCSR +NR+ RE Sbjct: 225 QHTSSRYSRERSCSRDRNREYRE 247 >DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. Length = 120 Score = 21.8 bits (44), Expect = 8.2 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = +2 Query: 533 CKVTGKCGSVTVRLIPAPRGT 595 C + G CG + + P+GT Sbjct: 75 CPICGACGDIAHTVKYCPKGT 95 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 8.2 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = +3 Query: 174 SCHQTRP-SCSRRKNRQTRE 230 S H +R SCSR +NR+ +E Sbjct: 228 SSHYSRERSCSRDRNREYKE 247 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.8 bits (44), Expect = 8.2 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +2 Query: 542 TGKCGSVTVRLIPAPRGTGIVSAPVS*EASSDGWCTGL 655 +GK + A + + IVS+P S G C GL Sbjct: 371 SGKKSKFNAAVAAAVQSSSIVSSPDSARHQRIGGCNGL 408 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 220,154 Number of Sequences: 438 Number of extensions: 4952 Number of successful extensions: 55 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27431202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -