BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0401.Seq (898 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07020.1 68415.m00803 protein kinase family protein contains ... 30 1.8 At3g25420.1 68416.m03161 serine carboxypeptidase S10 family prot... 30 2.4 At3g17920.1 68416.m02282 leucine-rich repeat family protein cont... 29 5.5 At1g72560.1 68414.m08391 tRNA export mediator exportin-t, putati... 29 5.5 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 29 5.5 >At2g07020.1 68415.m00803 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 700 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 283 DSSKLTTSDARPSVDWF*SNKSTHPITGQSSD 378 DS S RPS+DWF N+S + + SS+ Sbjct: 223 DSDLSFVSSDRPSMDWFEDNRSNYATSSSSSE 254 >At3g25420.1 68416.m03161 serine carboxypeptidase S10 family protein similar to serine carboxypeptidase I precursor (SP:P37890) from [Oryza sativa] Length = 505 Score = 29.9 bits (64), Expect = 2.4 Identities = 18/63 (28%), Positives = 25/63 (39%) Frame = +1 Query: 178 RDNHGSRRNYHRKLIRQTFERCVAGTDHAICKSYPDSSKLTTSDARPSVDWF*SNKSTHP 357 R + GS YHR L F + DH +C Y S T + VD + S + Sbjct: 401 RHDTGSMIEYHRNLTLSGFRALIFSGDHDMCVPYTGSEAWTKAMGYKVVDEWRPWMSNNQ 460 Query: 358 ITG 366 + G Sbjct: 461 VAG 463 >At3g17920.1 68416.m02282 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 962 Score = 28.7 bits (61), Expect = 5.5 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +2 Query: 101 RLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVAE 202 RLLPSL VV+ +P+ + P S LP + + V E Sbjct: 84 RLLPSLKVVSSLPSPARDPTPLSLLPFSKLKVLE 117 >At1g72560.1 68414.m08391 tRNA export mediator exportin-t, putative (PAUSED) contains Pfam profile: PF04150 exportin-t, identical to PAUSED gi:30909318 Length = 988 Score = 28.7 bits (61), Expect = 5.5 Identities = 14/57 (24%), Positives = 31/57 (54%) Frame = +2 Query: 245 SPVLTMRSAKVIQIHQN*RLRTRGPPSIGFDLIKALIPSLVRVLIACISSRITTVIQ 415 S +LT + +V++ H+ RL + ++ DL+ ++PS+ V+ C +++Q Sbjct: 301 SALLTGYAVEVLECHK--RLNSEDTKAVSMDLLNEVLPSVFYVMQKCEVDSTFSIVQ 355 >At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identical to gi_3883128_gb_AAC77827 Length = 133 Score = 28.7 bits (61), Expect = 5.5 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +2 Query: 110 PSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 217 PS A + APSP +NP P T V++ ES Sbjct: 39 PSQSPRATAPAPSPSANPPPSAPTTAPPVSQPPTES 74 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,351,942 Number of Sequences: 28952 Number of extensions: 325472 Number of successful extensions: 767 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 767 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2110422216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -