BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0397.Seq (784 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_06_0079 + 10429217-10429444,10430058-10430303,10430701-104307... 32 0.59 04_04_1262 + 32200823-32201190,32201311-32201818,32201927-322020... 31 1.4 >10_06_0079 + 10429217-10429444,10430058-10430303,10430701-10430746, 10430796-10431000,10432114-10432225 Length = 278 Score = 31.9 bits (69), Expect = 0.59 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = -3 Query: 671 PKPLPTAKGLG--QRLDSETYDDYLNTLKNSKDLPVLNEFLNFLERKFTTLE 522 P + KGL + +D E DDYL + LP L E +E+++ TLE Sbjct: 162 PSHVMQPKGLSSEEEVDDEVMDDYLFKSITKESLPHLCELFEKIEQQYATLE 213 >04_04_1262 + 32200823-32201190,32201311-32201818,32201927-32202031, 32202222-32202287,32202471-32202536,32202698-32202751, 32202895-32203041 Length = 437 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -2 Query: 504 DNGLPKHNIFQAGHHQQSTSGLQKHNYN 421 +NG H Q GHH S S L H+ N Sbjct: 124 NNGAGLHEFLQDGHHDMSASSLMNHSSN 151 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,994,567 Number of Sequences: 37544 Number of extensions: 335213 Number of successful extensions: 924 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 924 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2103658836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -