BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0395.Seq (887 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0581 - 30122279-30123124 31 1.2 >02_05_0581 - 30122279-30123124 Length = 281 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = +3 Query: 504 RRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRAEWR 647 RRL R+W +L RLA F W R RA WR Sbjct: 99 RRLPEREWTAEEDERLRRLAKENLFRQWWKVAREMPGRSGDSCRARWR 146 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,341,564 Number of Sequences: 37544 Number of extensions: 399207 Number of successful extensions: 990 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 961 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 990 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2495239620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -