BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0395.Seq (887 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66523-6|CAA91415.1| 161|Caenorhabditis elegans Hypothetical pr... 33 0.36 Z83233-10|CAB05768.2| 364|Caenorhabditis elegans Hypothetical p... 30 1.9 AF273799-1|AAG15148.1| 365|Caenorhabditis elegans nuclear recep... 30 1.9 AF273798-1|AAG15147.1| 366|Caenorhabditis elegans nuclear recep... 30 1.9 L14324-6|AAA28182.1| 3343|Caenorhabditis elegans Cadherin family... 29 5.9 >Z66523-6|CAA91415.1| 161|Caenorhabditis elegans Hypothetical protein M05D6.6 protein. Length = 161 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +1 Query: 34 PTEFQKTILVWTKKYKNKSEVPPFVSAEIIERSKSEARI 150 PT++Q+ LV TK Y + +++PP+V + R R+ Sbjct: 85 PTKWQRKFLVITKLYPSAADIPPYVHHGTMNRMHDRMRV 123 >Z83233-10|CAB05768.2| 364|Caenorhabditis elegans Hypothetical protein K06B4.11 protein. Length = 364 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -3 Query: 261 SQVHLMNRFPSLSSSFPRQYCSKTCQSSKKH 169 S HL+N F S SS P YC C+ + H Sbjct: 3 SPTHLLNNFESSSSQGPPSYCLICCEVADGH 33 >AF273799-1|AAG15148.1| 365|Caenorhabditis elegans nuclear receptor NHR-53 protein. Length = 365 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -3 Query: 261 SQVHLMNRFPSLSSSFPRQYCSKTCQSSKKH 169 S HL+N F S SS P YC C+ + H Sbjct: 4 SPTHLLNNFESSSSQGPPSYCLICCEVADGH 34 >AF273798-1|AAG15147.1| 366|Caenorhabditis elegans nuclear receptor NHR-53 protein. Length = 366 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -3 Query: 261 SQVHLMNRFPSLSSSFPRQYCSKTCQSSKKH 169 S HL+N F S SS P YC C+ + H Sbjct: 5 SPTHLLNNFESSSSQGPPSYCLICCEVADGH 35 >L14324-6|AAA28182.1| 3343|Caenorhabditis elegans Cadherin family protein 3 protein. Length = 3343 Score = 28.7 bits (61), Expect = 5.9 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +1 Query: 88 SEVPPFVSAEIIERSKSEARIKISNVLMLLTALASFGAILSGKAAAKRG 234 S++ PF+ I + + R +NVLMLL+++ G G+ A+ G Sbjct: 1082 SDMKPFMMTLIKDYLSEDVRFSTNNVLMLLSSIHPIGTSF-GRVTAESG 1129 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,240,756 Number of Sequences: 27780 Number of extensions: 353070 Number of successful extensions: 812 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 780 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 812 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2244863852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -