BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0393.Seq (906 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0510 - 21615724-21615909,21615992-21616075,21616164-216162... 29 5.1 01_06_0458 + 29531069-29531126,29531247-29531302,29531407-295315... 29 5.1 07_03_1695 - 28775525-28776098,28776586-28776693,28777129-28777448 29 6.7 >06_03_0510 - 21615724-21615909,21615992-21616075,21616164-21616217, 21616324-21616371,21616529-21616611,21616963-21617113, 21617648-21617785,21617966-21618094,21618391-21618596, 21618734-21618845,21619145-21619204,21619331-21619429, 21619520-21619575,21620230-21620313,21621407-21621500 Length = 527 Score = 29.1 bits (62), Expect = 5.1 Identities = 21/64 (32%), Positives = 34/64 (53%) Frame = +2 Query: 59 VAKLPLKPSCYSEISHPTGTLTGSSRTDYPREHKWLI*VQQLHSRXGYKRPYRVPSLTHY 238 + ++P+ +I+HPT LTG Y E + I +QLH+R Y +PSL+ Sbjct: 365 ITQIPILTMPNDDITHPTPDLTG-----YITEGQIYI-DRQLHNRQIYPPINVLPSLSRL 418 Query: 239 LKNA 250 +K+A Sbjct: 419 MKSA 422 >01_06_0458 + 29531069-29531126,29531247-29531302,29531407-29531505, 29531989-29532048,29532285-29532396,29532459-29532694, 29533092-29533220,29533325-29533462,29534043-29534193, 29534394-29534476,29534658-29534705,29534828-29534881, 29534971-29535054,29535152-29535337 Length = 497 Score = 29.1 bits (62), Expect = 5.1 Identities = 21/64 (32%), Positives = 34/64 (53%) Frame = +2 Query: 59 VAKLPLKPSCYSEISHPTGTLTGSSRTDYPREHKWLI*VQQLHSRXGYKRPYRVPSLTHY 238 + ++P+ +I+HPT LTG Y E + I +QLH+R Y +PSL+ Sbjct: 335 ITQIPILTMPNDDITHPTPDLTG-----YITEGQIYI-DRQLHNRQIYPPINVLPSLSRL 388 Query: 239 LKNA 250 +K+A Sbjct: 389 MKSA 392 >07_03_1695 - 28775525-28776098,28776586-28776693,28777129-28777448 Length = 333 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = +2 Query: 2 SFDNGITGAISS--SSEKLAIVAKLPLKPSCYSEISHPTGTLTGSSRTDY 145 SF N + +SS +SE A+ + LPL S ++ P+ ++ GS+ DY Sbjct: 240 SFANCHSPVLSSECASEAAALSSSLPLSAVVGSAVTTPSTSIVGSAPADY 289 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,960,751 Number of Sequences: 37544 Number of extensions: 317645 Number of successful extensions: 510 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 508 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2565528060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -